Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-ohsC/Ldr(toxin)
Location 1921773..1921994 Replicon chromosome
Accession NZ_CP104647
Organism Escherichia coli strain PNUSAE008406

Toxin (Protein)


Gene name ldrD Uniprot ID S1NWX0
Locus tag N5921_RS09865 Protein ID WP_001295224.1
Coordinates 1921773..1921880 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name ohsC
Locus tag -
Coordinates 1921929..1921994 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N5921_RS09840 (1917026) 1917026..1917778 - 753 Protein_1916 cellulose biosynthesis protein BcsQ -
N5921_RS09845 (1917790) 1917790..1917978 - 189 WP_001063316.1 cellulose biosynthesis protein BcsR -
N5921_RS09850 (1918251) 1918251..1919822 + 1572 WP_001204920.1 cellulose biosynthesis c-di-GMP-binding protein BcsE -
N5921_RS09855 (1919819) 1919819..1920010 + 192 WP_000988308.1 cellulose biosynthesis protein BcsF -
N5921_RS09860 (1920007) 1920007..1921686 + 1680 WP_000191596.1 cellulose biosynthesis protein BcsG -
N5921_RS09865 (1921773) 1921773..1921880 - 108 WP_001295224.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (1921929) 1921929..1921994 + 66 NuclAT_16 - Antitoxin
- (1921929) 1921929..1921994 + 66 NuclAT_16 - Antitoxin
- (1921929) 1921929..1921994 + 66 NuclAT_16 - Antitoxin
- (1921929) 1921929..1921994 + 66 NuclAT_16 - Antitoxin
- (1921929) 1921929..1921994 + 66 NuclAT_21 - Antitoxin
- (1921929) 1921929..1921994 + 66 NuclAT_21 - Antitoxin
- (1921929) 1921929..1921994 + 66 NuclAT_21 - Antitoxin
- (1921929) 1921929..1921994 + 66 NuclAT_21 - Antitoxin
N5921_RS09870 (1922356) 1922356..1923627 + 1272 WP_001301684.1 aromatic amino acid transport family protein -
N5921_RS09875 (1923657) 1923657..1924661 - 1005 WP_000107027.1 dipeptide ABC transporter ATP-binding subunit DppF -
N5921_RS09880 (1924658) 1924658..1925641 - 984 WP_001196486.1 dipeptide ABC transporter ATP-binding protein -
N5921_RS09885 (1925652) 1925652..1926554 - 903 WP_000084677.1 dipeptide ABC transporter permease DppC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3882.70 Da        Isoelectric Point: 9.0157

>T258819 WP_001295224.1 NZ_CP104647:c1921880-1921773 [Escherichia coli]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK

Download         Length: 108 bp

Antitoxin


Download         Length: 66 bp

>AT258819 NZ_CP104647:1921929-1921994 [Escherichia coli]
GTCTAGGTTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4P7TSJ7

Antitoxin

Download structure file

References