Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 1453013..1453740 | Replicon | chromosome |
Accession | NZ_CP104647 | ||
Organism | Escherichia coli strain PNUSAE008406 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9ZMR4 |
Locus tag | N5921_RS07525 | Protein ID | WP_000550189.1 |
Coordinates | 1453426..1453740 (-) | Length | 105 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | N5921_RS07520 | Protein ID | WP_000560249.1 |
Coordinates | 1453013..1453429 (-) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5921_RS07510 (1448073) | 1448073..1450424 | + | 2352 | WP_000695517.1 | alpha-glucosidase | - |
N5921_RS07515 (1450950) | 1450950..1452968 | + | 2019 | WP_000121479.1 | NADPH-dependent 2,4-dienoyl-CoA reductase | - |
N5921_RS07520 (1453013) | 1453013..1453429 | - | 417 | WP_000560249.1 | type II toxin-antitoxin system antitoxin HigA | Antitoxin |
N5921_RS07525 (1453426) | 1453426..1453740 | - | 315 | WP_000550189.1 | type II toxin-antitoxin system toxin HigB | Toxin |
N5921_RS07530 (1454024) | 1454024..1455160 | - | 1137 | WP_000018678.1 | 23S rRNA (guanine(1835)-N(2))-methyltransferase RlmG | - |
N5921_RS07535 (1455245) | 1455245..1455748 | + | 504 | WP_001295542.1 | M48 family metallopeptidase | - |
N5921_RS07540 (1455825) | 1455825..1456517 | + | 693 | WP_000942543.1 | vancomycin high temperature exclusion protein | - |
N5921_RS07545 (1456596) | 1456596..1457582 | + | 987 | WP_000617675.1 | Gfo/Idh/MocA family oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 12103.10 Da Isoelectric Point: 10.0409
>T258814 WP_000550189.1 NZ_CP104647:c1453740-1453426 [Escherichia coli]
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
Download Length: 315 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15016.48 Da Isoelectric Point: 4.5805
>AT258814 WP_000560249.1 NZ_CP104647:c1453429-1453013 [Escherichia coli]
MIAIADILHAGEKLTAVAPFLAGIQNEEQYIQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFAEFNAMAQAMPGG
IAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
MIAIADILHAGEKLTAVAPFLAGIQNEEQYIQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFAEFNAMAQAMPGG
IAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|