Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 27583..27808 Replicon chromosome
Accession NZ_CP104647
Organism Escherichia coli strain PNUSAE008406

Toxin (Protein)


Gene name hokW Uniprot ID S1ELB5
Locus tag N5921_RS00190 Protein ID WP_000813254.1
Coordinates 27583..27738 (-) Length 52 a.a.

Antitoxin (RNA)


Gene name sokW
Locus tag -
Coordinates 27750..27808 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N5921_RS00155 22868..23926 - 1059 WP_261589730.1 site-specific DNA-methyltransferase -
N5921_RS00160 24077..24274 - 198 WP_000917735.1 hypothetical protein -
N5921_RS00165 24501..25322 - 822 WP_000762902.1 antitermination protein -
N5921_RS00170 25319..25693 - 375 WP_000904171.1 RusA family crossover junction endodeoxyribonuclease -
N5921_RS00175 25706..26754 - 1049 Protein_33 DUF968 domain-containing protein -
N5921_RS00180 26756..27034 - 279 WP_072166534.1 hypothetical protein -
N5921_RS00185 27104..27361 - 258 WP_001217394.1 hypothetical protein -
N5921_RS00190 27583..27738 - 156 WP_000813254.1 type I toxin-antitoxin system toxin HokD Toxin
- 27750..27808 + 59 - - Antitoxin
N5921_RS00195 27984..28088 - 105 WP_001278450.1 hypothetical protein -
N5921_RS00200 28204..28566 - 363 WP_000610377.1 DUF551 domain-containing protein -
N5921_RS00205 28563..28934 - 372 WP_000137941.1 hypothetical protein -
N5921_RS00210 28970..29182 - 213 WP_000063625.1 hypothetical protein -
N5921_RS00215 29231..29587 - 357 WP_001302146.1 hypothetical protein -
N5921_RS00220 29644..30039 - 396 WP_001118161.1 DUF977 family protein -
N5921_RS00225 30055..30825 - 771 WP_000537576.1 DUF1627 domain-containing protein -
N5921_RS00230 30860..31321 - 462 WP_000139484.1 replication protein P -
N5921_RS00235 31314..32354 - 1041 WP_261589732.1 DnaT-like ssDNA-binding domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 64..39092 39028


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(6-47)


Sequences

Toxin        


Download         Length: 52 a.a.        Molecular weight: 5736.89 Da        Isoelectric Point: 6.1531

>T258811 WP_000813254.1 NZ_CP104647:c27738-27583 [Escherichia coli]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE

Download         Length: 156 bp

Antitoxin


Download         Length: 59 bp

>AT258811 NZ_CP104647:27750-27808 [Escherichia coli]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACGTGTGTAGAGCATAGATATGGCCTCA

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4P7TMW0

Antitoxin

Download structure file

References