Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 4987884..4988109 | Replicon | chromosome |
| Accession | NZ_CP104645 | ||
| Organism | Escherichia coli strain PNUSAE019785 | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | A0A1Q4PF16 |
| Locus tag | N5932_RS24715 | Protein ID | WP_000813258.1 |
| Coordinates | 4987884..4988039 (-) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 4988051..4988109 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5932_RS24665 | 4982887..4983318 | - | 432 | WP_001302123.1 | tellurite resistance protein | - |
| N5932_RS24680 | 4983769..4984482 | - | 714 | WP_000301797.1 | helix-turn-helix domain-containing protein | - |
| N5932_RS24685 | 4984618..4984815 | - | 198 | WP_000917763.1 | hypothetical protein | - |
| N5932_RS24690 | 4985040..4985594 | - | 555 | WP_000640035.1 | DUF1133 family protein | - |
| N5932_RS24695 | 4985657..4985962 | - | 306 | WP_001217444.1 | RusA family crossover junction endodeoxyribonuclease | - |
| N5932_RS24700 | 4985975..4987024 | - | 1050 | WP_001265229.1 | DUF968 domain-containing protein | - |
| N5932_RS24705 | 4987026..4987298 | - | 273 | WP_000191872.1 | hypothetical protein | - |
| N5932_RS24710 | 4987420..4987764 | - | 345 | WP_000756596.1 | YgiW/YdeI family stress tolerance OB fold protein | - |
| N5932_RS24715 | 4987884..4988039 | - | 156 | WP_000813258.1 | Hok/Gef family protein | Toxin |
| - | 4988051..4988109 | + | 59 | - | - | Antitoxin |
| N5932_RS24720 | 4988330..4988887 | - | 558 | WP_000104474.1 | DUF551 domain-containing protein | - |
| N5932_RS24725 | 4988889..4989107 | - | 219 | WP_000683609.1 | DUF4014 family protein | - |
| N5932_RS24730 | 4989235..4989546 | - | 312 | WP_001289673.1 | hypothetical protein | - |
| N5932_RS24735 | 4989539..4989766 | - | 228 | WP_000699809.1 | hypothetical protein | - |
| N5932_RS24740 | 4989763..4990044 | - | 282 | WP_000603384.1 | DNA-binding protein | - |
| N5932_RS24745 | 4990077..4990793 | - | 717 | WP_000450627.1 | DUF1627 domain-containing protein | - |
| N5932_RS24750 | 4990827..4991288 | - | 462 | WP_000139447.1 | replication protein P | - |
| N5932_RS24755 | 4991281..4992324 | - | 1044 | WP_001262402.1 | DnaT-like ssDNA-binding domain-containing protein | - |
| N5932_RS24760 | 4992393..4992818 | - | 426 | WP_000693878.1 | toxin YdaT family protein | - |
| N5932_RS24765 | 4992802..4993044 | - | 243 | WP_000747948.1 | Cro/CI family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 4957425..5048772 | 91347 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5767.95 Da Isoelectric Point: 7.7942
>T258804 WP_000813258.1 NZ_CP104645:c4988039-4987884 [Escherichia coli]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
Download Length: 156 bp
Antitoxin
Download Length: 59 bp
>AT258804 NZ_CP104645:4988051-4988109 [Escherichia coli]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|