Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 4987884..4988109 Replicon chromosome
Accession NZ_CP104645
Organism Escherichia coli strain PNUSAE019785

Toxin (Protein)


Gene name hokW Uniprot ID A0A1Q4PF16
Locus tag N5932_RS24715 Protein ID WP_000813258.1
Coordinates 4987884..4988039 (-) Length 52 a.a.

Antitoxin (RNA)


Gene name sokW
Locus tag -
Coordinates 4988051..4988109 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N5932_RS24665 4982887..4983318 - 432 WP_001302123.1 tellurite resistance protein -
N5932_RS24680 4983769..4984482 - 714 WP_000301797.1 helix-turn-helix domain-containing protein -
N5932_RS24685 4984618..4984815 - 198 WP_000917763.1 hypothetical protein -
N5932_RS24690 4985040..4985594 - 555 WP_000640035.1 DUF1133 family protein -
N5932_RS24695 4985657..4985962 - 306 WP_001217444.1 RusA family crossover junction endodeoxyribonuclease -
N5932_RS24700 4985975..4987024 - 1050 WP_001265229.1 DUF968 domain-containing protein -
N5932_RS24705 4987026..4987298 - 273 WP_000191872.1 hypothetical protein -
N5932_RS24710 4987420..4987764 - 345 WP_000756596.1 YgiW/YdeI family stress tolerance OB fold protein -
N5932_RS24715 4987884..4988039 - 156 WP_000813258.1 Hok/Gef family protein Toxin
- 4988051..4988109 + 59 - - Antitoxin
N5932_RS24720 4988330..4988887 - 558 WP_000104474.1 DUF551 domain-containing protein -
N5932_RS24725 4988889..4989107 - 219 WP_000683609.1 DUF4014 family protein -
N5932_RS24730 4989235..4989546 - 312 WP_001289673.1 hypothetical protein -
N5932_RS24735 4989539..4989766 - 228 WP_000699809.1 hypothetical protein -
N5932_RS24740 4989763..4990044 - 282 WP_000603384.1 DNA-binding protein -
N5932_RS24745 4990077..4990793 - 717 WP_000450627.1 DUF1627 domain-containing protein -
N5932_RS24750 4990827..4991288 - 462 WP_000139447.1 replication protein P -
N5932_RS24755 4991281..4992324 - 1044 WP_001262402.1 DnaT-like ssDNA-binding domain-containing protein -
N5932_RS24760 4992393..4992818 - 426 WP_000693878.1 toxin YdaT family protein -
N5932_RS24765 4992802..4993044 - 243 WP_000747948.1 Cro/CI family transcriptional regulator -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 4957425..5048772 91347


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(6-47)


Sequences

Toxin        


Download         Length: 52 a.a.        Molecular weight: 5767.95 Da        Isoelectric Point: 7.7942

>T258804 WP_000813258.1 NZ_CP104645:c4988039-4987884 [Escherichia coli]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK

Download         Length: 156 bp

Antitoxin


Download         Length: 59 bp

>AT258804 NZ_CP104645:4988051-4988109 [Escherichia coli]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1Q4PF16

Antitoxin

Download structure file

References