Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
Location | 3226352..3227046 | Replicon | chromosome |
Accession | NZ_CP104645 | ||
Organism | Escherichia coli strain PNUSAE019785 |
Toxin (Protein)
Gene name | yafO | Uniprot ID | C3TNX7 |
Locus tag | N5932_RS15885 | Protein ID | WP_001263495.1 |
Coordinates | 3226648..3227046 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | yafN | Uniprot ID | S1FJN6 |
Locus tag | N5932_RS15880 | Protein ID | WP_000554757.1 |
Coordinates | 3226352..3226645 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5932_RS15860 (3222063) | 3222063..3222560 | + | 498 | Protein_3075 | REP-associated tyrosine transposase RayT | - |
N5932_RS15865 (3222705) | 3222705..3224417 | - | 1713 | Protein_3076 | flagellar biosynthesis protein FlhA | - |
N5932_RS15870 (3224389) | 3224389..3225174 | + | 786 | WP_000207556.1 | putative lateral flagellar export/assembly protein LafU | - |
N5932_RS15875 (3225245) | 3225245..3226300 | + | 1056 | WP_001226186.1 | DNA polymerase IV | - |
N5932_RS15880 (3226352) | 3226352..3226645 | + | 294 | WP_000554757.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
N5932_RS15885 (3226648) | 3226648..3227046 | + | 399 | WP_001263495.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
N5932_RS15890 (3227056) | 3227056..3227508 | + | 453 | WP_001059871.1 | GNAT family N-acetyltransferase | - |
N5932_RS15895 (3227827) | 3227827..3228030 | + | 204 | Protein_3082 | RtcB family protein | - |
N5932_RS15900 (3228029) | 3228029..3228550 | + | 522 | Protein_3083 | peptide chain release factor H | - |
N5932_RS15905 (3228607) | 3228607..3230064 | - | 1458 | WP_001293009.1 | cytosol nonspecific dipeptidase | - |
N5932_RS15910 (3230325) | 3230325..3230783 | + | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
- (3231379) | 3231379..3231459 | + | 81 | NuclAT_11 | - | - |
- (3231379) | 3231379..3231459 | + | 81 | NuclAT_11 | - | - |
- (3231379) | 3231379..3231459 | + | 81 | NuclAT_11 | - | - |
- (3231379) | 3231379..3231459 | + | 81 | NuclAT_11 | - | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15473.86 Da Isoelectric Point: 8.0949
>T258796 WP_001263495.1 NZ_CP104645:3226648-3227046 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDESHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDESHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|