Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | symE-agrB/SymE(toxin) |
Location | 2872749..2873161 | Replicon | chromosome |
Accession | NZ_CP104645 | ||
Organism | Escherichia coli strain PNUSAE019785 |
Toxin (Protein)
Gene name | symE | Uniprot ID | Q8FA88 |
Locus tag | N5932_RS14265 | Protein ID | WP_000132630.1 |
Coordinates | 2872749..2873090 (-) | Length | 114 a.a. |
Antitoxin (RNA)
Gene name | agrB | ||
Locus tag | - | ||
Coordinates | 2873085..2873161 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5932_RS14245 (2868760) | 2868760..2870172 | - | 1413 | WP_000199295.1 | PLP-dependent aminotransferase family protein | - |
N5932_RS14250 (2870349) | 2870349..2870513 | + | 165 | WP_000394274.1 | DUF1127 domain-containing protein | - |
N5932_RS14255 (2870610) | 2870610..2871491 | + | 882 | WP_001304007.1 | DUF262 domain-containing protein | - |
N5932_RS14260 (2871539) | 2871539..2872702 | + | 1164 | WP_001304006.1 | DUF1524 domain-containing protein | - |
N5932_RS14265 (2872749) | 2872749..2873090 | - | 342 | WP_000132630.1 | endoribonuclease SymE | Toxin |
- (2873085) | 2873085..2873161 | + | 77 | NuclAT_14 | - | Antitoxin |
- (2873085) | 2873085..2873161 | + | 77 | NuclAT_14 | - | Antitoxin |
- (2873085) | 2873085..2873161 | + | 77 | NuclAT_14 | - | Antitoxin |
- (2873085) | 2873085..2873161 | + | 77 | NuclAT_14 | - | Antitoxin |
- (2873085) | 2873085..2873161 | + | 77 | NuclAT_15 | - | Antitoxin |
- (2873085) | 2873085..2873161 | + | 77 | NuclAT_15 | - | Antitoxin |
- (2873085) | 2873085..2873161 | + | 77 | NuclAT_15 | - | Antitoxin |
- (2873085) | 2873085..2873161 | + | 77 | NuclAT_15 | - | Antitoxin |
N5932_RS14270 (2873311) | 2873311..2875065 | - | 1755 | WP_000110082.1 | restriction endonuclease subunit S | - |
N5932_RS14275 (2875065) | 2875065..2876534 | - | 1470 | WP_001302468.1 | type I restriction-modification system subunit M | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | - | 2862242..2880962 | 18720 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12294.13 Da Isoelectric Point: 8.4982
>T258791 WP_000132630.1 NZ_CP104645:c2873090-2872749 [Escherichia coli]
MTDTHSIAQPFEAEVSPANNRQLTVSYASRYPDYSRIPAITLKGQWLEAAGFATGTVVDVKVMEGCIVLTAQPPAAAESE
LMQSLRQVCKLSARKQRQVQEFIGVIAGKQKVA
MTDTHSIAQPFEAEVSPANNRQLTVSYASRYPDYSRIPAITLKGQWLEAAGFATGTVVDVKVMEGCIVLTAQPPAAAESE
LMQSLRQVCKLSARKQRQVQEFIGVIAGKQKVA
Download Length: 342 bp
Antitoxin
Download Length: 77 bp
>AT258791 NZ_CP104645:2873085-2873161 [Escherichia coli]
AGTCATAACTGCTATTCCCTATAAATAGTGATTGTGATTAGCGGTGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
AGTCATAACTGCTATTCCCTATAAATAGTGATTGTGATTAGCGGTGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|