Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 1481138..1481937 | Replicon | chromosome |
Accession | NZ_CP104645 | ||
Organism | Escherichia coli strain PNUSAE019785 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | V0SSH7 |
Locus tag | N5932_RS07650 | Protein ID | WP_000347273.1 |
Coordinates | 1481473..1481937 (+) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | C3ST72 |
Locus tag | N5932_RS07645 | Protein ID | WP_001302819.1 |
Coordinates | 1481138..1481473 (+) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5932_RS07630 (1476923) | 1476923..1477693 | - | 771 | WP_001058231.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
N5932_RS07635 (1477709) | 1477709..1479043 | - | 1335 | WP_000599636.1 | galactarate/glucarate/glycerate transporter GarP | - |
N5932_RS07640 (1479418) | 1479418..1480989 | + | 1572 | WP_001273776.1 | galactarate dehydratase | - |
N5932_RS07645 (1481138) | 1481138..1481473 | + | 336 | WP_001302819.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
N5932_RS07650 (1481473) | 1481473..1481937 | + | 465 | WP_000347273.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
N5932_RS07655 (1481992) | 1481992..1482801 | - | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
N5932_RS07660 (1483050) | 1483050..1484330 | + | 1281 | WP_000681927.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
N5932_RS07665 (1484353) | 1484353..1484826 | + | 474 | WP_001301475.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
N5932_RS07670 (1484837) | 1484837..1485616 | + | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
N5932_RS07675 (1485606) | 1485606..1486484 | + | 879 | WP_001295548.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
N5932_RS07680 (1486502) | 1486502..1486936 | + | 435 | WP_000948831.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17836.25 Da Isoelectric Point: 9.6924
>T258783 WP_000347273.1 NZ_CP104645:1481473-1481937 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|