Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 1438260..1438987 | Replicon | chromosome |
Accession | NZ_CP104645 | ||
Organism | Escherichia coli strain PNUSAE019785 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9ZMR4 |
Locus tag | N5932_RS07425 | Protein ID | WP_000550189.1 |
Coordinates | 1438673..1438987 (-) | Length | 105 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | N5932_RS07420 | Protein ID | WP_000560249.1 |
Coordinates | 1438260..1438676 (-) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5932_RS07410 (1433321) | 1433321..1435672 | + | 2352 | WP_000695517.1 | alpha-glucosidase | - |
N5932_RS07415 (1436197) | 1436197..1438215 | + | 2019 | WP_000121479.1 | NADPH-dependent 2,4-dienoyl-CoA reductase | - |
N5932_RS07420 (1438260) | 1438260..1438676 | - | 417 | WP_000560249.1 | type II toxin-antitoxin system antitoxin HigA | Antitoxin |
N5932_RS07425 (1438673) | 1438673..1438987 | - | 315 | WP_000550189.1 | type II toxin-antitoxin system toxin HigB | Toxin |
N5932_RS07430 (1439271) | 1439271..1440407 | - | 1137 | WP_000018678.1 | 23S rRNA (guanine(1835)-N(2))-methyltransferase RlmG | - |
N5932_RS07435 (1440492) | 1440492..1440995 | + | 504 | WP_001295542.1 | M48 family metallopeptidase | - |
N5932_RS07440 (1441072) | 1441072..1441764 | + | 693 | WP_000942543.1 | vancomycin high temperature exclusion protein | - |
N5932_RS07445 (1441843) | 1441843..1442829 | + | 987 | WP_000617675.1 | Gfo/Idh/MocA family oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 12103.10 Da Isoelectric Point: 10.0409
>T258782 WP_000550189.1 NZ_CP104645:c1438987-1438673 [Escherichia coli]
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
Download Length: 315 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15016.48 Da Isoelectric Point: 4.5805
>AT258782 WP_000560249.1 NZ_CP104645:c1438676-1438260 [Escherichia coli]
MIAIADILHAGEKLTAVAPFLAGIQNEEQYIQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFAEFNAMAQAMPGG
IAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
MIAIADILHAGEKLTAVAPFLAGIQNEEQYIQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFAEFNAMAQAMPGG
IAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|