Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 162458..163212 | Replicon | chromosome |
| Accession | NZ_CP104643 | ||
| Organism | Salmonella enterica strain 1020677 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | B5RFE2 |
| Locus tag | N5930_RS00760 | Protein ID | WP_000558168.1 |
| Coordinates | 162458..162769 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | N5930_RS00765 | Protein ID | WP_001259009.1 |
| Coordinates | 162766..163212 (+) | Length | 149 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5930_RS00730 (158116) | 158116..159018 | + | 903 | WP_000331364.1 | formate dehydrogenase subunit beta | - |
| N5930_RS00735 (159015) | 159015..159650 | + | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
| N5930_RS00740 (159647) | 159647..160576 | + | 930 | WP_000027736.1 | formate dehydrogenase accessory protein FdhE | - |
| N5930_RS00745 (160623) | 160623..160913 | - | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | - |
| N5930_RS00750 (160914) | 160914..161225 | - | 312 | WP_001159635.1 | cytotoxic translational repressor of toxin-antitoxin stability system | - |
| N5930_RS00755 (161443) | 161443..162372 | + | 930 | WP_001127705.1 | alpha/beta hydrolase | - |
| N5930_RS00760 (162458) | 162458..162769 | + | 312 | WP_000558168.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| N5930_RS00765 (162766) | 162766..163212 | + | 447 | WP_001259009.1 | type II toxin-antitoxin system HigA family antitoxin | Antitoxin |
| N5930_RS00770 (163227) | 163227..164168 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
| N5930_RS00775 (164213) | 164213..164650 | - | 438 | WP_000560968.1 | D-aminoacyl-tRNA deacylase | - |
| N5930_RS00780 (164647) | 164647..165519 | - | 873 | WP_000921423.1 | virulence factor BrkB family protein | - |
| N5930_RS00785 (165513) | 165513..166112 | - | 600 | WP_000965695.1 | glucose-1-phosphatase | - |
| N5930_RS00790 (166303) | 166303..167106 | - | 804 | WP_000059693.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| N5930_RS00795 (167140) | 167140..168036 | - | 897 | WP_001520529.1 | sugar kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12324.26 Da Isoelectric Point: 9.3143
>T258760 WP_000558168.1 NZ_CP104643:162458-162769 [Salmonella enterica]
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTLTQPEEMKRYIPSLDNFKHRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYDRGNKE
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTLTQPEEMKRYIPSLDNFKHRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYDRGNKE
Download Length: 312 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16720.06 Da Isoelectric Point: 6.6451
>AT258760 WP_001259009.1 NZ_CP104643:162766-163212 [Salmonella enterica]
MRTHRQMDATSAKKIVDTFSDAVKSVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
MRTHRQMDATSAKKIVDTFSDAVKSVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|