Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 160623..161225 | Replicon | chromosome |
Accession | NZ_CP104643 | ||
Organism | Salmonella enterica strain 1020677 |
Toxin (Protein)
Gene name | higB | Uniprot ID | M7S4R6 |
Locus tag | N5930_RS00750 | Protein ID | WP_001159635.1 |
Coordinates | 160914..161225 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | N5930_RS00745 | Protein ID | WP_000362050.1 |
Coordinates | 160623..160913 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5930_RS00730 (158116) | 158116..159018 | + | 903 | WP_000331364.1 | formate dehydrogenase subunit beta | - |
N5930_RS00735 (159015) | 159015..159650 | + | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
N5930_RS00740 (159647) | 159647..160576 | + | 930 | WP_000027736.1 | formate dehydrogenase accessory protein FdhE | - |
N5930_RS00745 (160623) | 160623..160913 | - | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | Antitoxin |
N5930_RS00750 (160914) | 160914..161225 | - | 312 | WP_001159635.1 | cytotoxic translational repressor of toxin-antitoxin stability system | Toxin |
N5930_RS00755 (161443) | 161443..162372 | + | 930 | WP_001127705.1 | alpha/beta hydrolase | - |
N5930_RS00760 (162458) | 162458..162769 | + | 312 | WP_000558168.1 | type II toxin-antitoxin system HigB family toxin | - |
N5930_RS00765 (162766) | 162766..163212 | + | 447 | WP_001259009.1 | type II toxin-antitoxin system HigA family antitoxin | - |
N5930_RS00770 (163227) | 163227..164168 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
N5930_RS00775 (164213) | 164213..164650 | - | 438 | WP_000560968.1 | D-aminoacyl-tRNA deacylase | - |
N5930_RS00780 (164647) | 164647..165519 | - | 873 | WP_000921423.1 | virulence factor BrkB family protein | - |
N5930_RS00785 (165513) | 165513..166112 | - | 600 | WP_000965695.1 | glucose-1-phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12340.30 Da Isoelectric Point: 9.4460
>T258759 WP_001159635.1 NZ_CP104643:c161225-160914 [Salmonella enterica]
MQFIETELFTEDVKKLLDEDEYHKLQVFMAQHPDCGDVIQETGGLRKMRWGARGKGKRSGVRIIYFHRSQRYEIRLLLIY
QKGIKDDLTPQEKAVLRMLNERW
MQFIETELFTEDVKKLLDEDEYHKLQVFMAQHPDCGDVIQETGGLRKMRWGARGKGKRSGVRIIYFHRSQRYEIRLLLIY
QKGIKDDLTPQEKAVLRMLNERW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|