Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 4529533..4530287 | Replicon | chromosome |
| Accession | NZ_CP104641 | ||
| Organism | Salmonella enterica strain 1019942 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | B5RFE2 |
| Locus tag | N5927_RS22085 | Protein ID | WP_000558168.1 |
| Coordinates | 4529533..4529844 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | N5927_RS22090 | Protein ID | WP_001259009.1 |
| Coordinates | 4529841..4530287 (+) | Length | 149 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5927_RS22055 (4525191) | 4525191..4526093 | + | 903 | WP_000331364.1 | formate dehydrogenase subunit beta | - |
| N5927_RS22060 (4526090) | 4526090..4526725 | + | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
| N5927_RS22065 (4526722) | 4526722..4527651 | + | 930 | WP_000027736.1 | formate dehydrogenase accessory protein FdhE | - |
| N5927_RS22070 (4527698) | 4527698..4527988 | - | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | - |
| N5927_RS22075 (4527989) | 4527989..4528300 | - | 312 | WP_001159635.1 | cytotoxic translational repressor of toxin-antitoxin stability system | - |
| N5927_RS22080 (4528518) | 4528518..4529447 | + | 930 | WP_001127705.1 | alpha/beta hydrolase | - |
| N5927_RS22085 (4529533) | 4529533..4529844 | + | 312 | WP_000558168.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| N5927_RS22090 (4529841) | 4529841..4530287 | + | 447 | WP_001259009.1 | type II toxin-antitoxin system HigA family antitoxin | Antitoxin |
| N5927_RS22095 (4530302) | 4530302..4531243 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
| N5927_RS22100 (4531288) | 4531288..4531725 | - | 438 | WP_000560968.1 | D-aminoacyl-tRNA deacylase | - |
| N5927_RS22105 (4531722) | 4531722..4532594 | - | 873 | WP_000921423.1 | virulence factor BrkB family protein | - |
| N5927_RS22110 (4532588) | 4532588..4533187 | - | 600 | WP_000965695.1 | glucose-1-phosphatase | - |
| N5927_RS22115 (4533378) | 4533378..4534181 | - | 804 | WP_000059693.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| N5927_RS22120 (4534215) | 4534215..4535111 | - | 897 | WP_001520529.1 | sugar kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12324.26 Da Isoelectric Point: 9.3143
>T258757 WP_000558168.1 NZ_CP104641:4529533-4529844 [Salmonella enterica]
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTLTQPEEMKRYIPSLDNFKHRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYDRGNKE
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTLTQPEEMKRYIPSLDNFKHRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYDRGNKE
Download Length: 312 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16720.06 Da Isoelectric Point: 6.6451
>AT258757 WP_001259009.1 NZ_CP104641:4529841-4530287 [Salmonella enterica]
MRTHRQMDATSAKKIVDTFSDAVKSVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
MRTHRQMDATSAKKIVDTFSDAVKSVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|