Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ralRA/- |
| Location | 4708482..4708853 | Replicon | chromosome |
| Accession | NZ_CP104639 | ||
| Organism | Escherichia coli strain PNUSAE014970 | ||
Toxin (Protein)
| Gene name | ralR | Uniprot ID | A0A0D6ZRD3 |
| Locus tag | N4555_RS23135 | Protein ID | WP_001443846.1 |
| Coordinates | 4708704..4708853 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | ralA | ||
| Locus tag | - | ||
| Coordinates | 4708482..4708660 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N4555_RS23105 (4704234) | 4704234..4704404 | + | 171 | WP_001625136.1 | protein YnaL | - |
| N4555_RS23110 (4704437) | 4704437..4705810 | + | 1374 | WP_000123746.1 | ATP-dependent RNA helicase DbpA | - |
| N4555_RS23115 (4705939) | 4705939..4706874 | - | 936 | WP_001157407.1 | tRNA 2-thiocytidine(32) synthetase TtcA | - |
| N4555_RS23120 (4706926) | 4706926..4708161 | - | 1236 | WP_000040839.1 | site-specific integrase | - |
| N4555_RS23125 (4708163) | 4708163..4708378 | - | 216 | WP_000079604.1 | excisionase XisR | - |
| - (4708482) | 4708482..4708660 | + | 179 | NuclAT_0 | - | Antitoxin |
| - (4708482) | 4708482..4708660 | + | 179 | NuclAT_0 | - | Antitoxin |
| - (4708482) | 4708482..4708660 | + | 179 | NuclAT_0 | - | Antitoxin |
| - (4708482) | 4708482..4708660 | + | 179 | NuclAT_0 | - | Antitoxin |
| N4555_RS23130 (4708478) | 4708478..4708666 | - | 189 | WP_001302840.1 | DUF1187 family protein | - |
| N4555_RS23135 (4708704) | 4708704..4708853 | - | 150 | WP_001443846.1 | type I toxin-antitoxin system endodeoxyribonuclease toxin RalR | Toxin |
| N4555_RS23140 (4708909) | 4708909..4709718 | - | 810 | WP_000166313.1 | recombination protein RecT | - |
| N4555_RS23145 (4709711) | 4709711..4712311 | - | 2601 | WP_000105140.1 | exodeoxyribonuclease VIII | - |
| N4555_RS23150 (4712413) | 4712413..4712688 | - | 276 | WP_001344816.1 | hypothetical protein | - |
| N4555_RS23155 (4712763) | 4712763..4712933 | - | 171 | WP_001352098.1 | YdaE family protein | - |
| N4555_RS23160 (4712933) | 4712933..4713154 | - | 222 | WP_000560223.1 | killing protein KilR | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | nleG7' | 4694664..4804861 | 110197 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5383.12 Da Isoelectric Point: 8.3398
>T258727 WP_001443846.1 NZ_CP104639:c4708853-4708704 [Escherichia coli]
MRYDNVKPCPFCGCPSVTVKAISGYYRAKCNGCESRTGYGGSEKEALER
MRYDNVKPCPFCGCPSVTVKAISGYYRAKCNGCESRTGYGGSEKEALER
Download Length: 150 bp
Antitoxin
Download Length: 179 bp
>AT258727 NZ_CP104639:4708482-4708660 [Escherichia coli]
GAGGACTGAAGTTTCTCGCAATTAAAATTTATCAGTTTTACTTTCTGCTCTCTGGAAACGCCTGCTTCTTTTTTACCTGA
GAGCATTTTTTCGCATTCTGATTTCGTTAGTTTAGATTTTGAATATCTTGTCCAGTTAGTAGGAGTGCCACCTTCCTTTT
CAATAGTGGCGGTAATTTT
GAGGACTGAAGTTTCTCGCAATTAAAATTTATCAGTTTTACTTTCTGCTCTCTGGAAACGCCTGCTTCTTTTTTACCTGA
GAGCATTTTTTCGCATTCTGATTTCGTTAGTTTAGATTTTGAATATCTTGTCCAGTTAGTAGGAGTGCCACCTTCCTTTT
CAATAGTGGCGGTAATTTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
