Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
| Location | 3078422..3079116 | Replicon | chromosome |
| Accession | NZ_CP104639 | ||
| Organism | Escherichia coli strain PNUSAE014970 | ||
Toxin (Protein)
| Gene name | yafO | Uniprot ID | C3TNX7 |
| Locus tag | N4555_RS14760 | Protein ID | WP_001263495.1 |
| Coordinates | 3078718..3079116 (+) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | yafN | Uniprot ID | S1FJN6 |
| Locus tag | N4555_RS14755 | Protein ID | WP_000554757.1 |
| Coordinates | 3078422..3078715 (+) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N4555_RS14735 (3074133) | 3074133..3074630 | + | 498 | Protein_2859 | REP-associated tyrosine transposase RayT | - |
| N4555_RS14740 (3074775) | 3074775..3076487 | - | 1713 | Protein_2860 | flagellar biosynthesis protein FlhA | - |
| N4555_RS14745 (3076459) | 3076459..3077244 | + | 786 | WP_000207556.1 | putative lateral flagellar export/assembly protein LafU | - |
| N4555_RS14750 (3077315) | 3077315..3078370 | + | 1056 | WP_001226188.1 | DNA polymerase IV | - |
| N4555_RS14755 (3078422) | 3078422..3078715 | + | 294 | WP_000554757.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
| N4555_RS14760 (3078718) | 3078718..3079116 | + | 399 | WP_001263495.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
| N4555_RS14765 (3079126) | 3079126..3079578 | + | 453 | WP_001059871.1 | GNAT family N-acetyltransferase | - |
| N4555_RS14770 (3079897) | 3079897..3080100 | + | 204 | Protein_2866 | RtcB family protein | - |
| N4555_RS14775 (3080099) | 3080099..3080620 | + | 522 | Protein_2867 | peptide chain release factor H | - |
| N4555_RS14780 (3080677) | 3080677..3082134 | - | 1458 | WP_001293009.1 | cytosol nonspecific dipeptidase | - |
| N4555_RS14785 (3082395) | 3082395..3082853 | + | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
| - (3083449) | 3083449..3083529 | + | 81 | NuclAT_12 | - | - |
| - (3083449) | 3083449..3083529 | + | 81 | NuclAT_12 | - | - |
| - (3083449) | 3083449..3083529 | + | 81 | NuclAT_12 | - | - |
| - (3083449) | 3083449..3083529 | + | 81 | NuclAT_12 | - | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15473.86 Da Isoelectric Point: 8.0949
>T258722 WP_001263495.1 NZ_CP104639:3078718-3079116 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDESHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDESHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|