Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-agrB/Ldr(toxin) |
| Location | 1772267..1772488 | Replicon | chromosome |
| Accession | NZ_CP104639 | ||
| Organism | Escherichia coli strain PNUSAE014970 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | S1NWX0 |
| Locus tag | N4555_RS08745 | Protein ID | WP_001295224.1 |
| Coordinates | 1772267..1772374 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | agrB | ||
| Locus tag | - | ||
| Coordinates | 1772423..1772488 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N4555_RS08720 (1767520) | 1767520..1768272 | - | 753 | Protein_1699 | cellulose biosynthesis protein BcsQ | - |
| N4555_RS08725 (1768284) | 1768284..1768472 | - | 189 | WP_001063316.1 | cellulose biosynthesis protein BcsR | - |
| N4555_RS08730 (1768745) | 1768745..1770316 | + | 1572 | WP_261628855.1 | cellulose biosynthesis c-di-GMP-binding protein BcsE | - |
| N4555_RS08735 (1770313) | 1770313..1770504 | + | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
| N4555_RS08740 (1770501) | 1770501..1772180 | + | 1680 | WP_000191596.1 | cellulose biosynthesis protein BcsG | - |
| N4555_RS08745 (1772267) | 1772267..1772374 | - | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - (1772423) | 1772423..1772488 | + | 66 | NuclAT_17 | - | Antitoxin |
| - (1772423) | 1772423..1772488 | + | 66 | NuclAT_17 | - | Antitoxin |
| - (1772423) | 1772423..1772488 | + | 66 | NuclAT_17 | - | Antitoxin |
| - (1772423) | 1772423..1772488 | + | 66 | NuclAT_17 | - | Antitoxin |
| - (1772423) | 1772423..1772488 | + | 66 | NuclAT_22 | - | Antitoxin |
| - (1772423) | 1772423..1772488 | + | 66 | NuclAT_22 | - | Antitoxin |
| - (1772423) | 1772423..1772488 | + | 66 | NuclAT_22 | - | Antitoxin |
| - (1772423) | 1772423..1772488 | + | 66 | NuclAT_22 | - | Antitoxin |
| N4555_RS08750 (1772850) | 1772850..1774121 | + | 1272 | WP_001301684.1 | aromatic amino acid transport family protein | - |
| N4555_RS08755 (1774151) | 1774151..1775155 | - | 1005 | WP_000107027.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
| N4555_RS08760 (1775152) | 1775152..1776135 | - | 984 | WP_001196486.1 | dipeptide ABC transporter ATP-binding protein | - |
| N4555_RS08765 (1776146) | 1776146..1777048 | - | 903 | WP_000084677.1 | dipeptide ABC transporter permease DppC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3882.70 Da Isoelectric Point: 9.0157
>T258717 WP_001295224.1 NZ_CP104639:c1772374-1772267 [Escherichia coli]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
Download Length: 108 bp
Antitoxin
Download Length: 66 bp
>AT258717 NZ_CP104639:1772423-1772488 [Escherichia coli]
GTCTAGGTTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT
GTCTAGGTTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
