Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 1304849..1305576 | Replicon | chromosome |
Accession | NZ_CP104639 | ||
Organism | Escherichia coli strain PNUSAE014970 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9ZMR4 |
Locus tag | N4555_RS06405 | Protein ID | WP_000550189.1 |
Coordinates | 1305262..1305576 (-) | Length | 105 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | N4555_RS06400 | Protein ID | WP_000560249.1 |
Coordinates | 1304849..1305265 (-) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N4555_RS06390 (1299909) | 1299909..1302260 | + | 2352 | WP_000695517.1 | alpha-glucosidase | - |
N4555_RS06395 (1302786) | 1302786..1304804 | + | 2019 | WP_000121479.1 | NADPH-dependent 2,4-dienoyl-CoA reductase | - |
N4555_RS06400 (1304849) | 1304849..1305265 | - | 417 | WP_000560249.1 | type II toxin-antitoxin system antitoxin HigA | Antitoxin |
N4555_RS06405 (1305262) | 1305262..1305576 | - | 315 | WP_000550189.1 | type II toxin-antitoxin system toxin HigB | Toxin |
N4555_RS06410 (1305860) | 1305860..1306996 | - | 1137 | WP_000018678.1 | 23S rRNA (guanine(1835)-N(2))-methyltransferase RlmG | - |
N4555_RS06415 (1307081) | 1307081..1307584 | + | 504 | WP_001295542.1 | M48 family metallopeptidase | - |
N4555_RS06420 (1307661) | 1307661..1308353 | + | 693 | WP_000942543.1 | vancomycin high temperature exclusion protein | - |
N4555_RS06425 (1308432) | 1308432..1309418 | + | 987 | WP_000617675.1 | Gfo/Idh/MocA family oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 12103.10 Da Isoelectric Point: 10.0409
>T258712 WP_000550189.1 NZ_CP104639:c1305576-1305262 [Escherichia coli]
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
Download Length: 315 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15016.48 Da Isoelectric Point: 4.5805
>AT258712 WP_000560249.1 NZ_CP104639:c1305265-1304849 [Escherichia coli]
MIAIADILHAGEKLTAVAPFLAGIQNEEQYIQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFAEFNAMAQAMPGG
IAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
MIAIADILHAGEKLTAVAPFLAGIQNEEQYIQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFAEFNAMAQAMPGG
IAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|