Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 3461299..3462053 | Replicon | chromosome |
| Accession | NZ_CP104638 | ||
| Organism | Salmonella enterica strain PNUSAS118466 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | B5F003 |
| Locus tag | N4311_RS17975 | Protein ID | WP_000558166.1 |
| Coordinates | 3461299..3461610 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | N4311_RS17980 | Protein ID | WP_001259011.1 |
| Coordinates | 3461607..3462053 (+) | Length | 149 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N4311_RS17945 (3456957) | 3456957..3457859 | + | 903 | WP_000331364.1 | formate dehydrogenase subunit beta | - |
| N4311_RS17950 (3457856) | 3457856..3458491 | + | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
| N4311_RS17955 (3458488) | 3458488..3459417 | + | 930 | WP_000027730.1 | formate dehydrogenase accessory protein FdhE | - |
| N4311_RS17960 (3459464) | 3459464..3459754 | - | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | - |
| N4311_RS17965 (3459755) | 3459755..3460066 | - | 312 | WP_001159630.1 | cytotoxic translational repressor of toxin-antitoxin stability system | - |
| N4311_RS17970 (3460284) | 3460284..3461213 | + | 930 | WP_001127704.1 | alpha/beta hydrolase | - |
| N4311_RS17975 (3461299) | 3461299..3461610 | + | 312 | WP_000558166.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| N4311_RS17980 (3461607) | 3461607..3462053 | + | 447 | WP_001259011.1 | type II toxin-antitoxin system HigA family antitoxin | Antitoxin |
| N4311_RS17985 (3462068) | 3462068..3463009 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
| N4311_RS17990 (3463054) | 3463054..3463491 | - | 438 | WP_000560969.1 | D-aminoacyl-tRNA deacylase | - |
| N4311_RS17995 (3463488) | 3463488..3464360 | - | 873 | WP_000921423.1 | virulence factor BrkB family protein | - |
| N4311_RS18000 (3464354) | 3464354..3464953 | - | 600 | WP_000965695.1 | glucose-1-phosphatase | - |
| N4311_RS18005 (3465144) | 3465144..3465947 | - | 804 | WP_000059693.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| N4311_RS18010 (3465981) | 3465981..3466877 | - | 897 | WP_001520529.1 | sugar kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12432.40 Da Isoelectric Point: 9.5334
>T258705 WP_000558166.1 NZ_CP104638:3461299-3461610 [Salmonella enterica]
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
Download Length: 312 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16734.08 Da Isoelectric Point: 6.6451
>AT258705 WP_001259011.1 NZ_CP104638:3461607-3462053 [Salmonella enterica]
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|