Detailed information of TA system TA258689

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 101337..101763
• Replicon: plasmid pHNAH212872-1
• Accession: NZ_CP104631
• Organism: Escherichia coli strain AHM21C2872I

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: N5855_RS25360
• Protein ID: WP_001372321.1
• Coordinates: 101337..101462 (-)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	101539..101763 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
N5855_RS25315 (96382)	96382..96609	-	228	WP_001254386.1	conjugal transfer relaxosome protein TraY	-
N5855_RS25320 (96703)	96703..97389	-	687	WP_000332484.1	PAS domain-containing protein	-
N5855_RS25325 (97580)	97580..97963	-	384	WP_000124981.1	conjugal transfer relaxosome DNA-binding protein TraM	-
N5855_RS25330 (98240)	98240..98887	+	648	WP_000614936.1	transglycosylase SLT domain-containing protein	-
N5855_RS25335 (99184)	99184..100005	-	822	WP_001234469.1	DUF932 domain-containing protein	-
N5855_RS25340 (100128)	100128..100415	-	288	WP_000107535.1	hypothetical protein	-
N5855_RS25345 (100440)	100440..100646	-	207	WP_000547939.1	hypothetical protein	-
N5855_RS25350 (100716)	100716..100889	+	174	Protein_112	hypothetical protein	-
N5855_RS25355 (100887)	100887..101117	-	231	WP_001426396.1	hypothetical protein	-
N5855_RS25360 (101337)	101337..101462	-	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
N5855_RS25365 (101404)	101404..101553	-	150	Protein_115	plasmid maintenance protein Mok	-
- (101539)	101539..101763	-	225	NuclAT_0	-	Antitoxin
- (101539)	101539..101763	-	225	NuclAT_0	-	Antitoxin
- (101539)	101539..101763	-	225	NuclAT_0	-	Antitoxin
- (101539)	101539..101763	-	225	NuclAT_0	-	Antitoxin
N5855_RS25370 (101575)	101575..101763	+	189	WP_001299721.1	hypothetical protein	-
N5855_RS25375 (101732)	101732..102494	-	763	Protein_117	plasmid SOS inhibition protein A	-
N5855_RS25380 (102491)	102491..102925	-	435	WP_000845895.1	conjugation system SOS inhibitor PsiB	-
N5855_RS25385 (102980)	102980..104938	-	1959	WP_001145469.1	ParB/RepB/Spo0J family partition protein	-
N5855_RS25390 (104997)	104997..105230	-	234	WP_000006004.1	DUF905 domain-containing protein	-
N5855_RS25395 (105286)	105286..105813	-	528	WP_000290793.1	single-stranded DNA-binding protein	-
N5855_RS25400 (106286)	106286..106552	-	267	WP_072254135.1	hypothetical protein	-
N5855_RS25405 (106456)	106456..106704	-	249	WP_012311402.1	hypothetical protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T258689 WP_001372321.1 NZ_CP104631:c101462-101337 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 225 bp

>AT258689 NZ_CP104631:c101763-101539 [Escherichia coli]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Antitoxin