Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 4033032..4033634 | Replicon | chromosome |
| Accession | NZ_CP104629 | ||
| Organism | Escherichia coli strain AHM21C2872I | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | U9XIS6 |
| Locus tag | N5855_RS19320 | Protein ID | WP_000897305.1 |
| Coordinates | 4033032..4033343 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | N5855_RS19325 | Protein ID | WP_000356397.1 |
| Coordinates | 4033344..4033634 (+) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5855_RS19290 (4028062) | 4028062..4028847 | + | 786 | WP_000059678.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| N5855_RS19295 (4028946) | 4028946..4029545 | + | 600 | WP_001295269.1 | glucose-1-phosphatase | - |
| N5855_RS19300 (4029539) | 4029539..4030411 | + | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
| N5855_RS19305 (4030408) | 4030408..4030845 | + | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
| N5855_RS19310 (4030890) | 4030890..4031831 | + | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
| N5855_RS19315 (4031895) | 4031895..4032803 | - | 909 | WP_001162704.1 | alpha/beta hydrolase | - |
| N5855_RS19320 (4033032) | 4033032..4033343 | + | 312 | WP_000897305.1 | hypothetical protein | Toxin |
| N5855_RS19325 (4033344) | 4033344..4033634 | + | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
| N5855_RS19330 (4034220) | 4034220..4034438 | + | 219 | WP_001315930.1 | CopG family transcriptional regulator | - |
| N5855_RS19335 (4034658) | 4034658..4034900 | + | 243 | WP_001087409.1 | protein YiiF | - |
| N5855_RS19340 (4035230) | 4035230..4036159 | - | 930 | WP_000027708.1 | formate dehydrogenase accessory protein FdhE | - |
| N5855_RS19345 (4036156) | 4036156..4036791 | - | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
| N5855_RS19350 (4036788) | 4036788..4037690 | - | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T258684 WP_000897305.1 NZ_CP104629:4033032-4033343 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|