Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 3188845..3189644 | Replicon | chromosome |
Accession | NZ_CP104629 | ||
Organism | Escherichia coli strain AHM21C2872I |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | A0A161R7C1 |
Locus tag | N5855_RS15285 | Protein ID | WP_000347278.1 |
Coordinates | 3189180..3189644 (+) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | S1EB98 |
Locus tag | N5855_RS15280 | Protein ID | WP_001307405.1 |
Coordinates | 3188845..3189180 (+) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5855_RS15265 (3184630) | 3184630..3185400 | - | 771 | WP_001058227.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
N5855_RS15270 (3185416) | 3185416..3186750 | - | 1335 | WP_000599633.1 | galactarate/glucarate/glycerate transporter GarP | - |
N5855_RS15275 (3187125) | 3187125..3188696 | + | 1572 | WP_001273763.1 | galactarate dehydratase | - |
N5855_RS15280 (3188845) | 3188845..3189180 | + | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
N5855_RS15285 (3189180) | 3189180..3189644 | + | 465 | WP_000347278.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
N5855_RS15290 (3189699) | 3189699..3190508 | - | 810 | WP_000072174.1 | aga operon transcriptional regulator AgaR | - |
N5855_RS15295 (3190757) | 3190757..3192037 | + | 1281 | WP_021557243.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
N5855_RS15300 (3192060) | 3192060..3192533 | + | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
N5855_RS15305 (3192544) | 3192544..3193323 | + | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
N5855_RS15310 (3193313) | 3193313..3194191 | + | 879 | WP_021557244.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
N5855_RS15315 (3194209) | 3194209..3194643 | + | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 3180083..3189644 | 9561 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17866.28 Da Isoelectric Point: 9.6924
>T258682 WP_000347278.1 NZ_CP104629:3189180-3189644 [Escherichia coli]
MDFPQRVNGWALYTHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
MDFPQRVNGWALYTHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A161R7C1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XVC7 |