Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/Tad-HTH_37 |
| Location | 3820379..3820976 | Replicon | chromosome |
| Accession | NZ_CP104627 | ||
| Organism | Klebsiella pneumoniae strain AHM21C2836KI | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | R4YIC5 |
| Locus tag | N5857_RS18640 | Protein ID | WP_004142563.1 |
| Coordinates | 3820659..3820976 (-) | Length | 106 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | R4YH91 |
| Locus tag | N5857_RS18635 | Protein ID | WP_004142561.1 |
| Coordinates | 3820379..3820666 (-) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5857_RS18605 (3816459) | 3816459..3816707 | + | 249 | WP_002893037.1 | DUF1158 domain-containing protein | - |
| N5857_RS18610 (3816725) | 3816725..3817066 | - | 342 | WP_002893035.1 | RamA family antibiotic efflux transcriptional regulator | - |
| N5857_RS18615 (3817097) | 3817097..3818212 | - | 1116 | WP_012737592.1 | MBL fold metallo-hydrolase | - |
| N5857_RS18620 (3818392) | 3818392..3818973 | + | 582 | WP_004176968.1 | TetR/AcrR family transcriptional regulator | - |
| N5857_RS18625 (3818973) | 3818973..3819341 | + | 369 | WP_004142557.1 | MmcQ/YjbR family DNA-binding protein | - |
| N5857_RS18630 (3819461) | 3819461..3820114 | + | 654 | WP_004178896.1 | oxygen-insensitive NAD(P)H nitroreductase | - |
| N5857_RS18635 (3820379) | 3820379..3820666 | - | 288 | WP_004142561.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| N5857_RS18640 (3820659) | 3820659..3820976 | - | 318 | WP_004142563.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| N5857_RS18645 (3821161) | 3821161..3822204 | - | 1044 | WP_020802450.1 | DUF2157 domain-containing protein | - |
| N5857_RS18650 (3822870) | 3822870..3823736 | - | 867 | WP_004151823.1 | helix-turn-helix transcriptional regulator | - |
| N5857_RS18655 (3823845) | 3823845..3825272 | + | 1428 | WP_040181878.1 | MFS transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12110.39 Da Isoelectric Point: 11.2767
>T258664 WP_004142563.1 NZ_CP104627:c3820976-3820659 [Klebsiella pneumoniae]
MFRLVVHVDVKKELQALPPIVQAKMIRQLDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLFLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
MFRLVVHVDVKKELQALPPIVQAKMIRQLDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLFLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0M5MXH8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0S3DIQ1 |