Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 723481..724256 | Replicon | chromosome |
Accession | NZ_CP104627 | ||
Organism | Klebsiella pneumoniae strain AHM21C2836KI |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | A0A1W1JAQ8 |
Locus tag | N5857_RS03605 | Protein ID | WP_009308645.1 |
Coordinates | 723771..724256 (+) | Length | 162 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | W8UEW1 |
Locus tag | N5857_RS03600 | Protein ID | WP_004150912.1 |
Coordinates | 723481..723774 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5857_RS03580 (718689) | 718689..719291 | - | 603 | WP_004174410.1 | short chain dehydrogenase | - |
N5857_RS03585 (719389) | 719389..720300 | + | 912 | WP_023342207.1 | LysR family transcriptional regulator | - |
N5857_RS03590 (720301) | 720301..721449 | - | 1149 | WP_200541384.1 | PLP-dependent aspartate aminotransferase family protein | - |
N5857_RS03595 (721460) | 721460..722836 | - | 1377 | WP_167877958.1 | pyridoxal-phosphate dependent enzyme | - |
N5857_RS03600 (723481) | 723481..723774 | + | 294 | WP_004150912.1 | DUF1778 domain-containing protein | Antitoxin |
N5857_RS03605 (723771) | 723771..724256 | + | 486 | WP_009308645.1 | GNAT family N-acetyltransferase | Toxin |
N5857_RS03610 (724960) | 724960..725553 | + | 594 | WP_200541383.1 | hypothetical protein | - |
N5857_RS03615 (725650) | 725650..725866 | + | 217 | Protein_709 | transposase | - |
N5857_RS03625 (726707) | 726707..727420 | - | 714 | WP_002916694.1 | DUF554 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
flank | IS/Tn | - | - | 725650..725802 | 152 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17595.60 Da Isoelectric Point: 8.5144
>T258657 WP_009308645.1 NZ_CP104627:723771-724256 [Klebsiella pneumoniae]
MISAPEPLHAGHILTPFCCGIDSMDHWLKQRAMKNQVTGASRTFVCCDDAKVMAYYSLASSAVTTNTAPGRFRRNMPDPI
PVVVLGRLAVDKSLHGKGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEARDFYLRVGFEPSPMDPMMLMVTLRDLVN
A
MISAPEPLHAGHILTPFCCGIDSMDHWLKQRAMKNQVTGASRTFVCCDDAKVMAYYSLASSAVTTNTAPGRFRRNMPDPI
PVVVLGRLAVDKSLHGKGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEARDFYLRVGFEPSPMDPMMLMVTLRDLVN
A
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1W1JAQ8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GVL4 |