Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 82986..83239 | Replicon | plasmid pHNAH968-2 |
Accession | NZ_CP104621 | ||
Organism | Escherichia coli strain AHM9C68I |
Toxin (Protein)
Gene name | srnB | Uniprot ID | G9G1E3 |
Locus tag | N5859_RS24415 | Protein ID | WP_001312851.1 |
Coordinates | 83090..83239 (+) | Length | 50 a.a. |
Antitoxin (RNA)
Gene name | srnC | ||
Locus tag | - | ||
Coordinates | 82986..83045 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5859_RS24390 (79713) | 79713..80459 | + | 747 | WP_000205770.1 | conjugal transfer pilus acetylase TraX | - |
N5859_RS24395 (80514) | 80514..81074 | + | 561 | WP_063097573.1 | fertility inhibition protein FinO | - |
N5859_RS24400 (81206) | 81206..81406 | + | 201 | WP_015059022.1 | hypothetical protein | - |
N5859_RS24405 (81792) | 81792..82391 | + | 600 | WP_032083981.1 | PIN domain-containing protein | - |
N5859_RS24410 (82453) | 82453..82785 | + | 333 | WP_152916585.1 | hypothetical protein | - |
- (82986) | 82986..83045 | - | 60 | NuclAT_1 | - | Antitoxin |
- (82986) | 82986..83045 | - | 60 | NuclAT_1 | - | Antitoxin |
- (82986) | 82986..83045 | - | 60 | NuclAT_1 | - | Antitoxin |
- (82986) | 82986..83045 | - | 60 | NuclAT_1 | - | Antitoxin |
N5859_RS24415 (83090) | 83090..83239 | + | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
N5859_RS24420 (83523) | 83523..83771 | + | 249 | WP_000083837.1 | replication regulatory protein RepA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | blaCTX-M-55 / blaTEM-1B / rmtB | - | 1..84082 | 84082 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T258651 WP_001312851.1 NZ_CP104621:83090-83239 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 60 bp
>AT258651 NZ_CP104621:c83045-82986 [Escherichia coli]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|