Detailed information of TA system TA258649

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 43523..43792
• Replicon: plasmid pHNAH968-2
• Accession: NZ_CP104621
• Organism: Escherichia coli strain AHM9C68I

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: N5859_RS24185
• Protein ID: WP_001372321.1
• Coordinates: 43667..43792 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	43523..43588 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
N5859_RS24150	39233..39760	+	528	WP_000290834.1	single-stranded DNA-binding protein	-
N5859_RS24155	39818..40051	+	234	WP_000006003.1	DUF905 family protein	-
N5859_RS24160	40112..42135	+	2024	Protein_51	ParB/RepB/Spo0J family partition protein	-
N5859_RS24165	42204..42638	+	435	WP_000845953.1	conjugation system SOS inhibitor PsiB	-
N5859_RS24170	42635..43397	+	763	Protein_53	plasmid SOS inhibition protein A	-
-	43366..43590	+	225	NuclAT_0	-	-
-	43366..43590	+	225	NuclAT_0	-	-
-	43366..43590	+	225	NuclAT_0	-	-
-	43366..43590	+	225	NuclAT_0	-	-
N5859_RS24175	43375..43554	-	180	WP_001309233.1	hypothetical protein	-
-	43523..43588	-	66	-	-	Antitoxin
N5859_RS24180	43576..43725	+	150	Protein_55	plasmid maintenance protein Mok	-
N5859_RS24185	43667..43792	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
N5859_RS24190	44111..44407	-	297	Protein_57	hypothetical protein	-
N5859_RS24195	44707..45003	+	297	WP_001272251.1	hypothetical protein	-
N5859_RS24200	45114..45935	+	822	WP_001234445.1	DUF932 domain-containing protein	-
N5859_RS24205	46232..46879	-	648	WP_015059008.1	transglycosylase SLT domain-containing protein	-
N5859_RS24210	47156..47539	+	384	WP_000124981.1	conjugal transfer relaxosome DNA-binding protein TraM	-
N5859_RS24215	47730..48416	+	687	WP_001825184.1	PAS domain-containing protein	-
N5859_RS24220	48510..48737	+	228	WP_001254386.1	conjugal transfer relaxosome protein TraY	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	blaCTX-M-55 / blaTEM-1B / rmtB	-	1..84082	84082

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T258649 WP_001372321.1 NZ_CP104621:43667-43792 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 66 bp

>AT258649 NZ_CP104621:c43588-43523 [Escherichia coli]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT

Structures

Antitoxin