Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 50960..51386 | Replicon | plasmid pHNAH968-1 |
| Accession | NZ_CP104620 | ||
| Organism | Escherichia coli strain AHM9C68I | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | N5859_RS23675 | Protein ID | WP_001372321.1 |
| Coordinates | 51261..51386 (+) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 50960..51184 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5859_RS23630 (46186) | 46186..46413 | + | 228 | WP_071594011.1 | hypothetical protein | - |
| N5859_RS23635 (46654) | 46654..46860 | + | 207 | WP_000547971.1 | hypothetical protein | - |
| N5859_RS23640 (46886) | 46886..47425 | + | 540 | WP_000290812.1 | single-stranded DNA-binding protein | - |
| N5859_RS23645 (47487) | 47487..47720 | + | 234 | WP_000006030.1 | DUF905 family protein | - |
| N5859_RS23650 (47785) | 47785..49743 | + | 1959 | WP_284632911.1 | ParB/RepB/Spo0J family partition protein | - |
| N5859_RS23655 (49798) | 49798..50232 | + | 435 | WP_000845930.1 | conjugation system SOS inhibitor PsiB | - |
| N5859_RS23660 (50229) | 50229..50991 | + | 763 | Protein_64 | plasmid SOS inhibition protein A | - |
| N5859_RS23665 (50960) | 50960..51148 | - | 189 | WP_001299721.1 | hypothetical protein | - |
| - (50960) | 50960..51184 | + | 225 | NuclAT_0 | - | Antitoxin |
| - (50960) | 50960..51184 | + | 225 | NuclAT_0 | - | Antitoxin |
| - (50960) | 50960..51184 | + | 225 | NuclAT_0 | - | Antitoxin |
| - (50960) | 50960..51184 | + | 225 | NuclAT_0 | - | Antitoxin |
| N5859_RS23670 (51170) | 51170..51319 | + | 150 | Protein_66 | plasmid maintenance protein Mok | - |
| N5859_RS23675 (51261) | 51261..51386 | + | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| N5859_RS23680 (51606) | 51606..51836 | + | 231 | WP_001426396.1 | hypothetical protein | - |
| N5859_RS23685 (51834) | 51834..52007 | - | 174 | Protein_69 | hypothetical protein | - |
| N5859_RS23690 (52077) | 52077..52283 | + | 207 | WP_000547971.1 | hypothetical protein | - |
| N5859_RS23695 (52308) | 52308..52595 | + | 288 | WP_000107535.1 | hypothetical protein | - |
| N5859_RS23700 (52715) | 52715..53536 | + | 822 | WP_001234469.1 | DUF932 domain-containing protein | - |
| N5859_RS23705 (53833) | 53833..54480 | - | 648 | WP_137531447.1 | transglycosylase SLT domain-containing protein | - |
| N5859_RS23710 (54757) | 54757..55140 | + | 384 | WP_000124981.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| N5859_RS23715 (55331) | 55331..56017 | + | 687 | WP_001825184.1 | PAS domain-containing protein | - |
| N5859_RS23720 (56111) | 56111..56338 | + | 228 | WP_001254386.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | afaC-I | 1..89710 | 89710 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T258646 WP_001372321.1 NZ_CP104620:51261-51386 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 225 bp
>AT258646 NZ_CP104620:50960-51184 [Escherichia coli]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|