Detailed information of TA system TA258646

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 50960..51386
• Replicon: plasmid pHNAH968-1
• Accession: NZ_CP104620
• Organism: Escherichia coli strain AHM9C68I

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: N5859_RS23675
• Protein ID: WP_001372321.1
• Coordinates: 51261..51386 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	50960..51184 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
N5859_RS23630 (46186)	46186..46413	+	228	WP_071594011.1	hypothetical protein	-
N5859_RS23635 (46654)	46654..46860	+	207	WP_000547971.1	hypothetical protein	-
N5859_RS23640 (46886)	46886..47425	+	540	WP_000290812.1	single-stranded DNA-binding protein	-
N5859_RS23645 (47487)	47487..47720	+	234	WP_000006030.1	DUF905 family protein	-
N5859_RS23650 (47785)	47785..49743	+	1959	WP_284632911.1	ParB/RepB/Spo0J family partition protein	-
N5859_RS23655 (49798)	49798..50232	+	435	WP_000845930.1	conjugation system SOS inhibitor PsiB	-
N5859_RS23660 (50229)	50229..50991	+	763	Protein_64	plasmid SOS inhibition protein A	-
N5859_RS23665 (50960)	50960..51148	-	189	WP_001299721.1	hypothetical protein	-
- (50960)	50960..51184	+	225	NuclAT_0	-	Antitoxin
- (50960)	50960..51184	+	225	NuclAT_0	-	Antitoxin
- (50960)	50960..51184	+	225	NuclAT_0	-	Antitoxin
- (50960)	50960..51184	+	225	NuclAT_0	-	Antitoxin
N5859_RS23670 (51170)	51170..51319	+	150	Protein_66	plasmid maintenance protein Mok	-
N5859_RS23675 (51261)	51261..51386	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
N5859_RS23680 (51606)	51606..51836	+	231	WP_001426396.1	hypothetical protein	-
N5859_RS23685 (51834)	51834..52007	-	174	Protein_69	hypothetical protein	-
N5859_RS23690 (52077)	52077..52283	+	207	WP_000547971.1	hypothetical protein	-
N5859_RS23695 (52308)	52308..52595	+	288	WP_000107535.1	hypothetical protein	-
N5859_RS23700 (52715)	52715..53536	+	822	WP_001234469.1	DUF932 domain-containing protein	-
N5859_RS23705 (53833)	53833..54480	-	648	WP_137531447.1	transglycosylase SLT domain-containing protein	-
N5859_RS23710 (54757)	54757..55140	+	384	WP_000124981.1	conjugal transfer relaxosome DNA-binding protein TraM	-
N5859_RS23715 (55331)	55331..56017	+	687	WP_001825184.1	PAS domain-containing protein	-
N5859_RS23720 (56111)	56111..56338	+	228	WP_001254386.1	conjugal transfer relaxosome protein TraY	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	-	afaC-I	1..89710	89710

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T258646 WP_001372321.1 NZ_CP104620:51261-51386 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 225 bp

>AT258646 NZ_CP104620:50960-51184 [Escherichia coli]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Antitoxin