Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
| Location | 3622226..3622920 | Replicon | chromosome |
| Accession | NZ_CP104618 | ||
| Organism | Escherichia coli strain AHM9C68I | ||
Toxin (Protein)
| Gene name | yafO | Uniprot ID | S1EXB8 |
| Locus tag | N5859_RS17705 | Protein ID | WP_001263493.1 |
| Coordinates | 3622226..3622624 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | yafN | Uniprot ID | S1FJN6 |
| Locus tag | N5859_RS17710 | Protein ID | WP_000554757.1 |
| Coordinates | 3622627..3622920 (-) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| - (3617886) | 3617886..3617966 | - | 81 | NuclAT_9 | - | - |
| - (3617886) | 3617886..3617966 | - | 81 | NuclAT_9 | - | - |
| - (3617886) | 3617886..3617966 | - | 81 | NuclAT_9 | - | - |
| - (3617886) | 3617886..3617966 | - | 81 | NuclAT_9 | - | - |
| N5859_RS17675 (3617226) | 3617226..3618470 | - | 1245 | WP_000189541.1 | esterase FrsA | - |
| N5859_RS17680 (3618562) | 3618562..3619020 | - | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
| N5859_RS17685 (3619281) | 3619281..3620738 | + | 1458 | WP_001293003.1 | cytosol nonspecific dipeptidase | - |
| N5859_RS17690 (3620795) | 3620795..3621316 | - | 522 | Protein_3461 | peptide chain release factor H | - |
| N5859_RS17695 (3621315) | 3621315..3621518 | - | 204 | Protein_3462 | RtcB family protein | - |
| N5859_RS17700 (3621764) | 3621764..3622216 | - | 453 | WP_001059847.1 | GNAT family N-acetyltransferase | - |
| N5859_RS17705 (3622226) | 3622226..3622624 | - | 399 | WP_001263493.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
| N5859_RS17710 (3622627) | 3622627..3622920 | - | 294 | WP_000554757.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
| N5859_RS17715 (3622972) | 3622972..3624027 | - | 1056 | WP_001226164.1 | DNA polymerase IV | - |
| N5859_RS17720 (3624098) | 3624098..3624883 | - | 786 | WP_000207587.1 | putative lateral flagellar export/assembly protein LafU | - |
| N5859_RS17725 (3624855) | 3624855..3626567 | + | 1713 | Protein_3468 | flagellar biosynthesis protein FlhA | - |
| N5859_RS17730 (3626791) | 3626791..3627288 | - | 498 | WP_000006255.1 | REP-associated tyrosine transposase RayT | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | gmhA/lpcA | 3621264..3644481 | 23217 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15472.83 Da Isoelectric Point: 8.0949
>T258638 WP_001263493.1 NZ_CP104618:c3622624-3622226 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKQARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKQARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|