Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yafN-yafO (relBE)/YafO-YafN
Location 3622226..3622920 Replicon chromosome
Accession NZ_CP104618
Organism Escherichia coli strain AHM9C68I

Toxin (Protein)


Gene name yafO Uniprot ID S1EXB8
Locus tag N5859_RS17705 Protein ID WP_001263493.1
Coordinates 3622226..3622624 (-) Length 133 a.a.

Antitoxin (Protein)


Gene name yafN Uniprot ID S1FJN6
Locus tag N5859_RS17710 Protein ID WP_000554757.1
Coordinates 3622627..3622920 (-) Length 98 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
- (3617886) 3617886..3617966 - 81 NuclAT_9 - -
- (3617886) 3617886..3617966 - 81 NuclAT_9 - -
- (3617886) 3617886..3617966 - 81 NuclAT_9 - -
- (3617886) 3617886..3617966 - 81 NuclAT_9 - -
N5859_RS17675 (3617226) 3617226..3618470 - 1245 WP_000189541.1 esterase FrsA -
N5859_RS17680 (3618562) 3618562..3619020 - 459 WP_001291990.1 xanthine phosphoribosyltransferase -
N5859_RS17685 (3619281) 3619281..3620738 + 1458 WP_001293003.1 cytosol nonspecific dipeptidase -
N5859_RS17690 (3620795) 3620795..3621316 - 522 Protein_3461 peptide chain release factor H -
N5859_RS17695 (3621315) 3621315..3621518 - 204 Protein_3462 RtcB family protein -
N5859_RS17700 (3621764) 3621764..3622216 - 453 WP_001059847.1 GNAT family N-acetyltransferase -
N5859_RS17705 (3622226) 3622226..3622624 - 399 WP_001263493.1 type II toxin-antitoxin system mRNA interferase toxin YafO Toxin
N5859_RS17710 (3622627) 3622627..3622920 - 294 WP_000554757.1 type I toxin-antitoxin system antitoxin YafN Antitoxin
N5859_RS17715 (3622972) 3622972..3624027 - 1056 WP_001226164.1 DNA polymerase IV -
N5859_RS17720 (3624098) 3624098..3624883 - 786 WP_000207587.1 putative lateral flagellar export/assembly protein LafU -
N5859_RS17725 (3624855) 3624855..3626567 + 1713 Protein_3468 flagellar biosynthesis protein FlhA -
N5859_RS17730 (3626791) 3626791..3627288 - 498 WP_000006255.1 REP-associated tyrosine transposase RayT -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - gmhA/lpcA 3621264..3644481 23217


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase toxin YafO

(27-130)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 133 a.a.        Molecular weight: 15472.83 Da        Isoelectric Point: 8.0949

>T258638 WP_001263493.1 NZ_CP104618:c3622624-3622226 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKQARDNNQMHKIGKMAEAFRMRF

Download         Length: 399 bp

Antitoxin


Download         Length: 98 a.a.        Molecular weight: 11233.81 Da        Isoelectric Point: 5.9050

>AT258638 WP_000554757.1 NZ_CP104618:c3622920-3622627 [Escherichia coli]
MHRILAEKSVNITELRKNPAKYFIDQPVAVLSNNRPAGYLLSASAFEALMDMLAEQEEKKPIKARFRPSAARLEEITRRA
EKYLNDMTDDDFNDFKE

Download         Length: 294 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S1EXB8

Antitoxin

Source ID Structure
AlphaFold DB S1FJN6

References