Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 649411..650138 | Replicon | chromosome |
| Accession | NZ_CP104618 | ||
| Organism | Escherichia coli strain AHM9C68I | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | U9ZMR4 |
| Locus tag | N5859_RS03165 | Protein ID | WP_000550189.1 |
| Coordinates | 649411..649725 (+) | Length | 105 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | N5859_RS03170 | Protein ID | WP_000560266.1 |
| Coordinates | 649722..650138 (+) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5859_RS03145 (645578) | 645578..646564 | - | 987 | WP_023281494.1 | Gfo/Idh/MocA family oxidoreductase | - |
| N5859_RS03150 (646643) | 646643..647326 | - | 684 | WP_001183042.1 | vancomycin high temperature exclusion protein | - |
| N5859_RS03155 (647403) | 647403..647906 | - | 504 | WP_001295542.1 | M48 family metallopeptidase | - |
| N5859_RS03160 (647991) | 647991..649127 | + | 1137 | WP_000018695.1 | 23S rRNA (guanine(1835)-N(2))-methyltransferase RlmG | - |
| N5859_RS03165 (649411) | 649411..649725 | + | 315 | WP_000550189.1 | type II toxin-antitoxin system toxin HigB | Toxin |
| N5859_RS03170 (649722) | 649722..650138 | + | 417 | WP_000560266.1 | type II toxin-antitoxin system antitoxin HigA | Antitoxin |
| N5859_RS03175 (650183) | 650183..652201 | - | 2019 | WP_049253702.1 | NADPH-dependent 2,4-dienoyl-CoA reductase | - |
| N5859_RS03180 (652627) | 652627..654978 | - | 2352 | WP_024238710.1 | alpha-glucosidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 12103.10 Da Isoelectric Point: 10.0409
>T258626 WP_000550189.1 NZ_CP104618:649411-649725 [Escherichia coli]
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
Download Length: 315 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 14995.42 Da Isoelectric Point: 4.4547
>AT258626 WP_000560266.1 NZ_CP104618:649722-650138 [Escherichia coli]
MIAIADILQAGEKLTAVAPFLAGIQNEEQYTQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFAEFNAMAQAMPGG
IAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
MIAIADILQAGEKLTAVAPFLAGIQNEEQYTQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFAEFNAMAQAMPGG
IAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|