Detailed information of TA system TA258620

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 85243..85669
• Replicon: plasmid pHNAH8212R-1
• Accession: NZ_CP104614
• Organism: Escherichia coli strain AHM8C212RI

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: N5856_RS24145
• Protein ID: WP_001372321.1
• Coordinates: 85243..85368 (-)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	85445..85669 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
N5856_RS24100 (80287)	80287..80514	-	228	WP_001254386.1	conjugal transfer relaxosome protein TraY	-
N5856_RS24105 (80608)	80608..81294	-	687	WP_000332484.1	PAS domain-containing protein	-
N5856_RS24110 (81485)	81485..81868	-	384	WP_000124981.1	conjugal transfer relaxosome DNA-binding protein TraM	-
N5856_RS24115 (82145)	82145..82792	+	648	WP_000614936.1	transglycosylase SLT domain-containing protein	-
N5856_RS24120 (83089)	83089..83910	-	822	WP_001234469.1	DUF932 domain-containing protein	-
N5856_RS24125 (84034)	84034..84321	-	288	WP_000107535.1	hypothetical protein	-
N5856_RS24130 (84346)	84346..84552	-	207	WP_000547939.1	hypothetical protein	-
N5856_RS24135 (84622)	84622..84795	+	174	Protein_92	hypothetical protein	-
N5856_RS24140 (84793)	84793..85023	-	231	WP_001426396.1	hypothetical protein	-
N5856_RS24145 (85243)	85243..85368	-	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
N5856_RS24150 (85310)	85310..85459	-	150	Protein_95	plasmid maintenance protein Mok	-
- (85447)	85447..85512	+	66	NuclAT_0	-	-
- (85447)	85447..85512	-	66	NuclAT_1	-	-
- (85445)	85445..85669	+	225	NuclAT_0	-	-
- (85445)	85445..85669	-	225	NuclAT_0	-	Antitoxin
- (85445)	85445..85669	-	225	NuclAT_0	-	Antitoxin
- (85445)	85445..85669	-	225	NuclAT_0	-	Antitoxin
- (85445)	85445..85669	-	225	NuclAT_0	-	Antitoxin
N5856_RS24155 (85481)	85481..85669	+	189	WP_001299721.1	hypothetical protein	-
N5856_RS24160 (85638)	85638..86400	-	763	Protein_97	plasmid SOS inhibition protein A	-
N5856_RS24165 (86397)	86397..86831	-	435	WP_000845895.1	conjugation system SOS inhibitor PsiB	-
N5856_RS24170 (86886)	86886..88844	-	1959	WP_001145469.1	ParB/RepB/Spo0J family partition protein	-
N5856_RS24175 (88903)	88903..89136	-	234	WP_000006004.1	DUF905 domain-containing protein	-
N5856_RS24180 (89192)	89192..89719	-	528	WP_000290793.1	single-stranded DNA-binding protein	-
N5856_RS24185 (90192)	90192..90452	-	261	WP_072132736.1	hypothetical protein	-
N5856_RS24190 (90362)	90362..90604	-	243	WP_001610271.1	hypothetical protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T258620 WP_001372321.1 NZ_CP104614:c85368-85243 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 225 bp

>AT258620 NZ_CP104614:c85669-85445 [Escherichia coli]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Antitoxin