Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 13609..14266 | Replicon | plasmid pHNAH8161B |
| Accession | NZ_CP104606 | ||
| Organism | Klebsiella pneumoniae strain AHM8C161BI | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | U3PDC3 |
| Locus tag | N5862_RS29040 | Protein ID | WP_000270043.1 |
| Coordinates | 13916..14266 (-) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | N5862_RS29035 | Protein ID | WP_000124640.1 |
| Coordinates | 13609..13911 (-) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5862_RS28990 (N5862_28980) | 9234..9662 | + | 429 | WP_000591074.1 | hypothetical protein | - |
| N5862_RS28995 (N5862_28985) | 9719..10078 | + | 360 | WP_000422768.1 | hypothetical protein | - |
| N5862_RS29000 (N5862_28990) | 10078..10524 | + | 447 | WP_000919345.1 | Fe3+-siderophore ABC transporter permease | - |
| N5862_RS29005 (N5862_28995) | 10521..11039 | + | 519 | WP_000210756.1 | nitrite reductase | - |
| N5862_RS29010 (N5862_29000) | 11039..11269 | + | 231 | WP_000972663.1 | hypothetical protein | - |
| N5862_RS29015 (N5862_29005) | 11256..12113 | + | 858 | WP_001167032.1 | hypothetical protein | - |
| N5862_RS29020 (N5862_29010) | 12344..12871 | + | 528 | WP_001236377.1 | thermonuclease family protein | - |
| N5862_RS29025 (N5862_29015) | 12929..13201 | + | 273 | WP_001043047.1 | HU family DNA-binding protein | - |
| N5862_RS29030 (N5862_29020) | 13289..13582 | + | 294 | WP_001239997.1 | chromosome segregation protein ParM | - |
| N5862_RS29035 (N5862_29025) | 13609..13911 | - | 303 | WP_000124640.1 | XRE family transcriptional regulator | Antitoxin |
| N5862_RS29040 (N5862_29030) | 13916..14266 | - | 351 | WP_000270043.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| N5862_RS29045 (N5862_29035) | 14429..14977 | + | 549 | WP_001061574.1 | transcriptional regulator | - |
| N5862_RS29050 (N5862_29040) | 15318..15512 | + | 195 | WP_000343597.1 | hypothetical protein | - |
| N5862_RS29055 (N5862_29045) | 15523..15894 | + | 372 | WP_000516916.1 | hypothetical protein | - |
| N5862_RS29060 (N5862_29050) | 15887..16357 | + | 471 | WP_001281821.1 | hypothetical protein | - |
| N5862_RS29065 (N5862_29055) | 16372..16707 | - | 336 | WP_000683476.1 | hypothetical protein | - |
| N5862_RS29070 (N5862_29060) | 16804..17292 | + | 489 | WP_001273096.1 | DUF1643 domain-containing protein | - |
| N5862_RS29075 (N5862_29065) | 17295..17792 | + | 498 | WP_000062185.1 | hypothetical protein | - |
| N5862_RS29080 (N5862_29070) | 18007..18711 | - | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | aac(3)-IId / aac(6')-Ib-cr / ARR-3 / dfrA27 / aadA16 / qacE / sul1 / blaNDM-1 / mph(A) / floR / tet(A) / aph(3')-Ia / aph(6)-Id / aph(3'')-Ib / sul2 | - | 1..159878 | 159878 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 13328.21 Da Isoelectric Point: 5.2421
>T258592 WP_000270043.1 NZ_CP104606:c14266-13916 [Klebsiella pneumoniae]
MWVIETTDTFDEWFDALDDTDRANVLASMMVLRDRGPMLSRPYADTVNGSSYSNMKELRVQSKGDPIRAFFAFDPKRKGI
LLCAGNKTGDEKRFYEVMIPIADREFAAHLDKLKKE
MWVIETTDTFDEWFDALDDTDRANVLASMMVLRDRGPMLSRPYADTVNGSSYSNMKELRVQSKGDPIRAFFAFDPKRKGI
LLCAGNKTGDEKRFYEVMIPIADREFAAHLDKLKKE
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|