258592

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/COG4683-HTH_37
Location 13609..14266 Replicon plasmid pHNAH8161B
Accession NZ_CP104606
Organism Klebsiella pneumoniae strain AHM8C161BI

Toxin (Protein)


Gene name higB Uniprot ID U3PDC3
Locus tag N5862_RS29040 Protein ID WP_000270043.1
Coordinates 13916..14266 (-) Length 117 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag N5862_RS29035 Protein ID WP_000124640.1
Coordinates 13609..13911 (-) Length 101 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N5862_RS28990 (N5862_28980) 9234..9662 + 429 WP_000591074.1 hypothetical protein -
N5862_RS28995 (N5862_28985) 9719..10078 + 360 WP_000422768.1 hypothetical protein -
N5862_RS29000 (N5862_28990) 10078..10524 + 447 WP_000919345.1 Fe3+-siderophore ABC transporter permease -
N5862_RS29005 (N5862_28995) 10521..11039 + 519 WP_000210756.1 nitrite reductase -
N5862_RS29010 (N5862_29000) 11039..11269 + 231 WP_000972663.1 hypothetical protein -
N5862_RS29015 (N5862_29005) 11256..12113 + 858 WP_001167032.1 hypothetical protein -
N5862_RS29020 (N5862_29010) 12344..12871 + 528 WP_001236377.1 thermonuclease family protein -
N5862_RS29025 (N5862_29015) 12929..13201 + 273 WP_001043047.1 HU family DNA-binding protein -
N5862_RS29030 (N5862_29020) 13289..13582 + 294 WP_001239997.1 chromosome segregation protein ParM -
N5862_RS29035 (N5862_29025) 13609..13911 - 303 WP_000124640.1 XRE family transcriptional regulator Antitoxin
N5862_RS29040 (N5862_29030) 13916..14266 - 351 WP_000270043.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
N5862_RS29045 (N5862_29035) 14429..14977 + 549 WP_001061574.1 transcriptional regulator -
N5862_RS29050 (N5862_29040) 15318..15512 + 195 WP_000343597.1 hypothetical protein -
N5862_RS29055 (N5862_29045) 15523..15894 + 372 WP_000516916.1 hypothetical protein -
N5862_RS29060 (N5862_29050) 15887..16357 + 471 WP_001281821.1 hypothetical protein -
N5862_RS29065 (N5862_29055) 16372..16707 - 336 WP_000683476.1 hypothetical protein -
N5862_RS29070 (N5862_29060) 16804..17292 + 489 WP_001273096.1 DUF1643 domain-containing protein -
N5862_RS29075 (N5862_29065) 17295..17792 + 498 WP_000062185.1 hypothetical protein -
N5862_RS29080 (N5862_29070) 18007..18711 - 705 WP_001067855.1 IS6-like element IS26 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid aac(3)-IId / aac(6')-Ib-cr / ARR-3 / dfrA27 / aadA16 / qacE / sul1 / blaNDM-1 / mph(A) / floR / tet(A) / aph(3')-Ia / aph(6)-Id / aph(3'')-Ib / sul2 - 1..159878 159878


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-like

(12-106)

Antitoxin

Cro/C1-type helix-turn-helix domain

(33-79)


Sequences

Toxin        


Download         Length: 117 a.a.        Molecular weight: 13328.21 Da        Isoelectric Point: 5.2421

>T258592 WP_000270043.1 NZ_CP104606:c14266-13916 [Klebsiella pneumoniae]
MWVIETTDTFDEWFDALDDTDRANVLASMMVLRDRGPMLSRPYADTVNGSSYSNMKELRVQSKGDPIRAFFAFDPKRKGI
LLCAGNKTGDEKRFYEVMIPIADREFAAHLDKLKKE

Download         Length: 351 bp

Antitoxin


Download         Length: 101 a.a.        Molecular weight: 11006.73 Da        Isoelectric Point: 7.2036

>AT258592 WP_000124640.1 NZ_CP104606:c13911-13609 [Klebsiella pneumoniae]
MARTLDQMLATEKPEVVAKAQKAATEMLLNIHLAELRDRMNLTQGEIAASLGVRQPTVSEMEKPGRDLKLSSIKRYVEAS
GGKLRLDVELPDGTHYGFAV

Download         Length: 303 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7G8AFB9

Antitoxin

Source ID Structure

References