Detailed information of TA system TA258568

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 85247..85673
• Replicon: plasmid pHNAH8160R-1
• Accession: NZ_CP104599
• Organism: Escherichia coli strain AHM8C160RI

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: N5861_RS24145
• Protein ID: WP_001372321.1
• Coordinates: 85247..85372 (-)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	85449..85673 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
N5861_RS24100 (80291)	80291..80518	-	228	WP_001254386.1	conjugal transfer relaxosome protein TraY	-
N5861_RS24105 (80612)	80612..81298	-	687	WP_000332484.1	PAS domain-containing protein	-
N5861_RS24110 (81489)	81489..81872	-	384	WP_000124981.1	conjugal transfer relaxosome DNA-binding protein TraM	-
N5861_RS24115 (82149)	82149..82796	+	648	WP_000614936.1	transglycosylase SLT domain-containing protein	-
N5861_RS24120 (83093)	83093..83914	-	822	WP_001234469.1	DUF932 domain-containing protein	-
N5861_RS24125 (84038)	84038..84325	-	288	WP_000107535.1	hypothetical protein	-
N5861_RS24130 (84350)	84350..84556	-	207	WP_000547939.1	hypothetical protein	-
N5861_RS24135 (84626)	84626..84799	+	174	Protein_92	hypothetical protein	-
N5861_RS24140 (84797)	84797..85027	-	231	WP_001426396.1	hypothetical protein	-
N5861_RS24145 (85247)	85247..85372	-	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
N5861_RS24150 (85314)	85314..85463	-	150	Protein_95	plasmid maintenance protein Mok	-
- (85451)	85451..85516	+	66	NuclAT_0	-	-
- (85451)	85451..85516	-	66	NuclAT_1	-	-
- (85449)	85449..85673	+	225	NuclAT_0	-	-
- (85449)	85449..85673	-	225	NuclAT_0	-	Antitoxin
- (85449)	85449..85673	-	225	NuclAT_0	-	Antitoxin
- (85449)	85449..85673	-	225	NuclAT_0	-	Antitoxin
- (85449)	85449..85673	-	225	NuclAT_0	-	Antitoxin
N5861_RS24155 (85485)	85485..85673	+	189	WP_001299721.1	hypothetical protein	-
N5861_RS24160 (85642)	85642..86404	-	763	Protein_97	plasmid SOS inhibition protein A	-
N5861_RS24165 (86401)	86401..86835	-	435	WP_000845895.1	conjugation system SOS inhibitor PsiB	-
N5861_RS24170 (86890)	86890..88848	-	1959	WP_001145469.1	ParB/RepB/Spo0J family partition protein	-
N5861_RS24175 (88907)	88907..89140	-	234	WP_000006004.1	DUF905 domain-containing protein	-
N5861_RS24180 (89196)	89196..89723	-	528	WP_000290793.1	single-stranded DNA-binding protein	-
N5861_RS24185 (90196)	90196..90456	-	261	WP_072132736.1	hypothetical protein	-
N5861_RS24190 (90366)	90366..90608	-	243	WP_001610271.1	hypothetical protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T258568 WP_001372321.1 NZ_CP104599:c85372-85247 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 225 bp

>AT258568 NZ_CP104599:c85673-85449 [Escherichia coli]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Antitoxin