Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 4042950..4043749 | Replicon | chromosome |
Accession | NZ_CP104598 | ||
Organism | Escherichia coli strain AHM8C160RI |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | V0SSH7 |
Locus tag | N5861_RS19455 | Protein ID | WP_000347273.1 |
Coordinates | 4043285..4043749 (+) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | S1EB98 |
Locus tag | N5861_RS19450 | Protein ID | WP_001307405.1 |
Coordinates | 4042950..4043285 (+) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5861_RS19435 (4038734) | 4038734..4039504 | - | 771 | WP_024250085.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
N5861_RS19440 (4039520) | 4039520..4040854 | - | 1335 | WP_097702292.1 | galactarate/glucarate/glycerate transporter GarP | - |
N5861_RS19445 (4041229) | 4041229..4042800 | + | 1572 | WP_097489939.1 | galactarate dehydratase | - |
N5861_RS19450 (4042950) | 4042950..4043285 | + | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
N5861_RS19455 (4043285) | 4043285..4043749 | + | 465 | WP_000347273.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
N5861_RS19460 (4043804) | 4043804..4044613 | - | 810 | WP_000072180.1 | aga operon transcriptional regulator AgaR | - |
N5861_RS19465 (4044862) | 4044862..4046142 | + | 1281 | WP_000681920.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
N5861_RS19470 (4046165) | 4046165..4046638 | + | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
N5861_RS19475 (4046649) | 4046649..4047428 | + | 780 | WP_033557704.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
N5861_RS19480 (4047418) | 4047418..4048296 | + | 879 | WP_001298758.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
N5861_RS19485 (4048314) | 4048314..4048748 | + | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 4033799..4043749 | 9950 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17836.25 Da Isoelectric Point: 9.6924
>T258564 WP_000347273.1 NZ_CP104598:4043285-4043749 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | V0SSH7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XVC7 |