Detailed information of TA system TA258539

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 5561..5987
• Replicon: plasmid pEC9952-1
• Accession: NZ_CP104596
• Organism: Escherichia coli strain EC9952

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: N5B57_RS23845
• Protein ID: WP_001372321.1
• Coordinates: 5561..5686 (-)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	5763..5987 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
N5B57_RS23810 (584)	584..811	-	228	WP_000089263.1	conjugal transfer relaxosome protein TraY	-
N5B57_RS23815 (948)	948..1619	-	672	WP_000283561.1	conjugal transfer transcriptional regulator TraJ	-
N5B57_RS23820 (1813)	1813..2196	-	384	WP_001354030.1	conjugal transfer relaxosome DNA-binding protein TraM	-
N5B57_RS23825 (2531)	2531..3121	+	591	WP_000252683.1	transglycosylase SLT domain-containing protein	-
N5B57_RS23830 (3418)	3418..4239	-	822	WP_001234445.1	DUF932 domain-containing protein	-
N5B57_RS23835 (4350)	4350..4646	-	297	WP_001272251.1	hypothetical protein	-
N5B57_RS23840 (4946)	4946..5242	+	297	Protein_8	hypothetical protein	-
N5B57_RS23845 (5561)	5561..5686	-	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
N5B57_RS23850 (5628)	5628..5777	-	150	Protein_10	plasmid maintenance protein Mok	-
N5B57_RS23855 (5799)	5799..5978	+	180	WP_001309233.1	hypothetical protein	-
- (5763)	5763..5987	-	225	NuclAT_0	-	Antitoxin
- (5763)	5763..5987	-	225	NuclAT_0	-	Antitoxin
- (5763)	5763..5987	-	225	NuclAT_0	-	Antitoxin
- (5763)	5763..5987	-	225	NuclAT_0	-	Antitoxin
N5B57_RS23860 (5956)	5956..6718	-	763	Protein_12	plasmid SOS inhibition protein A	-
N5B57_RS23865 (6715)	6715..7149	-	435	WP_000845953.1	conjugation system SOS inhibitor PsiB	-
N5B57_RS23870 (7218)	7218..9186	-	1969	Protein_14	ParB/RepB/Spo0J family partition protein	-
N5B57_RS23875 (9247)	9247..9480	-	234	WP_000006003.1	DUF905 family protein	-
N5B57_RS23880 (9538)	9538..10065	-	528	WP_000290834.1	single-stranded DNA-binding protein	-
N5B57_RS23885 (10367)	10367..10822	+	456	Protein_17	hypothetical protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	sitABCD / tet(M) / ant(3'')-Ia / cmlA1 / aadA2 / dfrA12 / floR / sul2 / aph(3')-Ia / sul3 / blaCTX-M-27 / mph(A) / aac(3)-IId / blaTEM-1B	iutA / iucD / iucC / iucB / iucA	1..157264	157264

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T258539 WP_001372321.1 NZ_CP104596:c5686-5561 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 225 bp

>AT258539 NZ_CP104596:c5987-5763 [Escherichia coli]
TCACACAGATTACCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTACCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Antitoxin