Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 4722258..4722860 | Replicon | chromosome |
Accession | NZ_CP104595 | ||
Organism | Escherichia coli strain EC9952 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9XIS6 |
Locus tag | N5B57_RS22820 | Protein ID | WP_000897305.1 |
Coordinates | 4722549..4722860 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | N5B57_RS22815 | Protein ID | WP_000356397.1 |
Coordinates | 4722258..4722548 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5B57_RS22790 (4718183) | 4718183..4719085 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
N5B57_RS22795 (4719082) | 4719082..4719717 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
N5B57_RS22800 (4719714) | 4719714..4720643 | + | 930 | WP_000027708.1 | formate dehydrogenase accessory protein FdhE | - |
N5B57_RS22805 (4720973) | 4720973..4721215 | - | 243 | WP_001087409.1 | protein YiiF | - |
N5B57_RS22810 (4721435) | 4721435..4721653 | - | 219 | WP_001315930.1 | CopG family transcriptional regulator | - |
N5B57_RS22815 (4722258) | 4722258..4722548 | - | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
N5B57_RS22820 (4722549) | 4722549..4722860 | - | 312 | WP_000897305.1 | hypothetical protein | Toxin |
N5B57_RS22825 (4723089) | 4723089..4723997 | + | 909 | WP_021293166.1 | alpha/beta hydrolase | - |
N5B57_RS22830 (4724061) | 4724061..4725002 | - | 942 | WP_001343389.1 | fatty acid biosynthesis protein FabY | - |
N5B57_RS22835 (4725047) | 4725047..4725484 | - | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
N5B57_RS22840 (4725481) | 4725481..4726353 | - | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
N5B57_RS22845 (4726347) | 4726347..4726946 | - | 600 | WP_001295269.1 | glucose-1-phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T258538 WP_000897305.1 NZ_CP104595:c4722860-4722549 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|