Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 602957..603756 | Replicon | chromosome |
Accession | NZ_CP104595 | ||
Organism | Escherichia coli strain EC9952 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | U9XVR9 |
Locus tag | N5B57_RS02930 | Protein ID | WP_000347267.1 |
Coordinates | 602957..603421 (-) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | S1EB98 |
Locus tag | N5B57_RS02935 | Protein ID | WP_001307405.1 |
Coordinates | 603421..603756 (-) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5B57_RS02900 (597958) | 597958..598392 | - | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
N5B57_RS02905 (598410) | 598410..599288 | - | 879 | WP_001298758.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
N5B57_RS02910 (599278) | 599278..600057 | - | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
N5B57_RS02915 (600068) | 600068..600541 | - | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
N5B57_RS02920 (600564) | 600564..601844 | - | 1281 | WP_195717708.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
N5B57_RS02925 (602093) | 602093..602902 | + | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
N5B57_RS02930 (602957) | 602957..603421 | - | 465 | WP_000347267.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
N5B57_RS02935 (603421) | 603421..603756 | - | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
N5B57_RS02940 (603905) | 603905..605476 | - | 1572 | WP_001273741.1 | galactarate dehydratase | - |
N5B57_RS02945 (605851) | 605851..607185 | + | 1335 | WP_087889555.1 | galactarate/glucarate/glycerate transporter GarP | - |
N5B57_RS02950 (607201) | 607201..607971 | + | 771 | WP_001058227.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17807.17 Da Isoelectric Point: 9.4947
>T258521 WP_000347267.1 NZ_CP104595:c603421-602957 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XTR4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XVC7 |