Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-VapI |
| Location | 3365563..3366158 | Replicon | chromosome |
| Accession | NZ_CP104590 | ||
| Organism | Pseudomonas aeruginosa strain WTJH36 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A241XLJ5 |
| Locus tag | N5878_RS15785 | Protein ID | WP_003117425.1 |
| Coordinates | 3365880..3366158 (-) | Length | 93 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | N5878_RS15780 | Protein ID | WP_003099268.1 |
| Coordinates | 3365563..3365868 (-) | Length | 102 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5878_RS15745 (N5878_15745) | 3361016..3361306 | - | 291 | WP_023083237.1 | DUF5447 family protein | - |
| N5878_RS15750 (N5878_15750) | 3361310..3361525 | - | 216 | WP_031629304.1 | hypothetical protein | - |
| N5878_RS15755 (N5878_15755) | 3361518..3361790 | - | 273 | WP_003115921.1 | hypothetical protein | - |
| N5878_RS15760 (N5878_15760) | 3361900..3362166 | + | 267 | WP_016852153.1 | hypothetical protein | - |
| N5878_RS15765 (N5878_15765) | 3362298..3363134 | + | 837 | WP_223656480.1 | helix-turn-helix domain-containing protein | - |
| N5878_RS15770 (N5878_15770) | 3363109..3364647 | + | 1539 | WP_023082696.1 | GNAT family N-acetyltransferase | - |
| N5878_RS15775 (N5878_15775) | 3364659..3365186 | - | 528 | WP_071535723.1 | ATP-binding protein | - |
| N5878_RS15780 (N5878_15780) | 3365563..3365868 | - | 306 | WP_003099268.1 | HigA family addiction module antitoxin | Antitoxin |
| N5878_RS15785 (N5878_15785) | 3365880..3366158 | - | 279 | WP_003117425.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| N5878_RS15790 (N5878_15790) | 3366211..3366339 | - | 129 | Protein_3122 | integrase | - |
| N5878_RS15795 (N5878_15795) | 3366487..3368715 | + | 2229 | WP_003099265.1 | TonB-dependent receptor | - |
| N5878_RS15800 (N5878_15800) | 3368785..3369432 | - | 648 | WP_003095021.1 | carbonate dehydratase | - |
| N5878_RS15805 (N5878_15805) | 3369494..3370732 | - | 1239 | WP_014603324.1 | C69 family dipeptidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10701.28 Da Isoelectric Point: 8.5576
>T258513 WP_003117425.1 NZ_CP104590:c3366158-3365880 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAARELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAARELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|