Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-VapI |
Location | 5863145..5863740 | Replicon | chromosome |
Accession | NZ_CP104588 | ||
Organism | Pseudomonas aeruginosa strain WTJH32 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A241XLJ5 |
Locus tag | N5879_RS27325 | Protein ID | WP_003117425.1 |
Coordinates | 5863462..5863740 (-) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | N5879_RS27320 | Protein ID | WP_003099268.1 |
Coordinates | 5863145..5863450 (-) | Length | 102 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5879_RS27290 (N5879_27290) | 5858598..5858888 | - | 291 | WP_023083237.1 | DUF5447 family protein | - |
N5879_RS27295 (N5879_27295) | 5859100..5859372 | - | 273 | WP_003115921.1 | hypothetical protein | - |
N5879_RS27300 (N5879_27300) | 5859482..5859748 | + | 267 | WP_016852153.1 | hypothetical protein | - |
N5879_RS27305 (N5879_27305) | 5859880..5860716 | + | 837 | WP_223656480.1 | helix-turn-helix domain-containing protein | - |
N5879_RS27310 (N5879_27310) | 5860691..5862229 | + | 1539 | WP_023082696.1 | GNAT family N-acetyltransferase | - |
N5879_RS27315 (N5879_27315) | 5862241..5862768 | - | 528 | WP_071535723.1 | ATP-binding protein | - |
N5879_RS27320 (N5879_27320) | 5863145..5863450 | - | 306 | WP_003099268.1 | HigA family addiction module antitoxin | Antitoxin |
N5879_RS27325 (N5879_27325) | 5863462..5863740 | - | 279 | WP_003117425.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
N5879_RS27330 (N5879_27330) | 5863793..5863921 | - | 129 | Protein_5403 | integrase | - |
N5879_RS27335 (N5879_27335) | 5864069..5866297 | + | 2229 | WP_003099265.1 | TonB-dependent receptor | - |
N5879_RS27340 (N5879_27340) | 5866367..5867014 | - | 648 | WP_003095021.1 | carbonate dehydratase | - |
N5879_RS27345 (N5879_27345) | 5867076..5868314 | - | 1239 | WP_014603324.1 | C69 family dipeptidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10701.28 Da Isoelectric Point: 8.5576
>T258509 WP_003117425.1 NZ_CP104588:c5863740-5863462 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAARELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAARELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|