Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 4926513..4927194 | Replicon | chromosome |
| Accession | NZ_CP104586 | ||
| Organism | Pseudomonas aeruginosa strain WTJH6 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | N5877_RS22810 | Protein ID | WP_015503432.1 |
| Coordinates | 4926513..4926878 (+) | Length | 122 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | N5877_RS22815 | Protein ID | WP_016561576.1 |
| Coordinates | 4926871..4927194 (+) | Length | 108 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5877_RS22780 (N5877_22780) | 4922518..4922952 | - | 435 | WP_003158601.1 | RidA family protein | - |
| N5877_RS22785 (N5877_22785) | 4923173..4924126 | + | 954 | WP_003085661.1 | LysR substrate-binding domain-containing protein | - |
| N5877_RS22790 (N5877_22790) | 4924099..4924983 | - | 885 | WP_019725847.1 | LysR substrate-binding domain-containing protein | - |
| N5877_RS22795 (N5877_22795) | 4925084..4925509 | + | 426 | WP_003163196.1 | VOC family protein | - |
| N5877_RS22800 (N5877_22800) | 4925528..4925800 | - | 273 | WP_003085667.1 | hypothetical protein | - |
| N5877_RS22805 (N5877_22805) | 4926007..4926249 | + | 243 | WP_043884955.1 | hypothetical protein | - |
| N5877_RS22810 (N5877_22810) | 4926513..4926878 | + | 366 | WP_015503432.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| N5877_RS22815 (N5877_22815) | 4926871..4927194 | + | 324 | WP_016561576.1 | XRE family transcriptional regulator | Antitoxin |
| N5877_RS22820 (N5877_22820) | 4927310..4927429 | - | 120 | Protein_4495 | IS5/IS1182 family transposase | - |
| N5877_RS22825 (N5877_22825) | 4927424..4927816 | + | 393 | Protein_4496 | hypothetical protein | - |
| N5877_RS22830 (N5877_22830) | 4927816..4928819 | + | 1004 | Protein_4497 | tyrosine-type recombinase/integrase | - |
| N5877_RS22835 (N5877_22835) | 4929036..4929287 | + | 252 | WP_124136459.1 | hypothetical protein | - |
| N5877_RS22840 (N5877_22840) | 4929317..4930183 | + | 867 | WP_023081971.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 122 a.a. Molecular weight: 13798.14 Da Isoelectric Point: 4.8219
>T258497 WP_015503432.1 NZ_CP104586:4926513-4926878 [Pseudomonas aeruginosa]
VAWDIEYTDEFGDWWGSLSEDEQESLAVTVRLLEERGPSLGHPHSSGINGSRPGHMRELRTQHGGRPFRTLYAFDPRRSA
ILPIGGDKTGDDRWYELNVPIADRLHDEHLHQLREEGLIDG
VAWDIEYTDEFGDWWGSLSEDEQESLAVTVRLLEERGPSLGHPHSSGINGSRPGHMRELRTQHGGRPFRTLYAFDPRRSA
ILPIGGDKTGDDRWYELNVPIADRLHDEHLHQLREEGLIDG
Download Length: 366 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|