Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-VapI |
| Location | 5869589..5870184 | Replicon | chromosome |
| Accession | NZ_CP104584 | ||
| Organism | Pseudomonas aeruginosa strain WTJH2 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A241XLJ5 |
| Locus tag | N5876_RS27375 | Protein ID | WP_003117425.1 |
| Coordinates | 5869906..5870184 (-) | Length | 93 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | N5876_RS27370 | Protein ID | WP_003099268.1 |
| Coordinates | 5869589..5869894 (-) | Length | 102 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5876_RS27340 (N5876_27340) | 5865042..5865332 | - | 291 | WP_023083237.1 | DUF5447 family protein | - |
| N5876_RS27345 (N5876_27345) | 5865544..5865816 | - | 273 | WP_003115921.1 | hypothetical protein | - |
| N5876_RS27350 (N5876_27350) | 5865926..5866192 | + | 267 | WP_016852153.1 | hypothetical protein | - |
| N5876_RS27355 (N5876_27355) | 5866324..5867160 | + | 837 | WP_223656480.1 | helix-turn-helix domain-containing protein | - |
| N5876_RS27360 (N5876_27360) | 5867135..5868673 | + | 1539 | WP_023082696.1 | GNAT family N-acetyltransferase | - |
| N5876_RS27365 (N5876_27365) | 5868685..5869212 | - | 528 | WP_071535723.1 | ATP-binding protein | - |
| N5876_RS27370 (N5876_27370) | 5869589..5869894 | - | 306 | WP_003099268.1 | HigA family addiction module antitoxin | Antitoxin |
| N5876_RS27375 (N5876_27375) | 5869906..5870184 | - | 279 | WP_003117425.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| N5876_RS27380 (N5876_27380) | 5870237..5870365 | - | 129 | Protein_5413 | integrase | - |
| N5876_RS27385 (N5876_27385) | 5870513..5872741 | + | 2229 | WP_003099265.1 | TonB-dependent receptor | - |
| N5876_RS27390 (N5876_27390) | 5872811..5873458 | - | 648 | WP_003095021.1 | carbonate dehydratase | - |
| N5876_RS27395 (N5876_27395) | 5873520..5874758 | - | 1239 | WP_014603324.1 | C69 family dipeptidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10701.28 Da Isoelectric Point: 8.5576
>T258491 WP_003117425.1 NZ_CP104584:c5870184-5869906 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAARELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAARELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|