Detailed information of TA system TA258481

Bioinformatically predicted

Overview

TA module

• Type: II
• Classification (family/domain): mqsRA (relBE)/MqsR-MqsA
• Location: 2386987..2387687
• Replicon: chromosome
• Accession: NZ_CP104583
• Organism: Pseudomonas sp. GD03721

Toxin (Protein)

• Gene name: mqsR
• Uniprot ID: -
• Locus tag: N5O88_RS11505
• Protein ID: WP_279530416.1
• Coordinates: 2386987..2387283 (+)
• Length: 99 a.a.

Antitoxin (Protein)

• Gene name: mqsA
• Uniprot ID: -
• Locus tag: N5O88_RS11510
• Protein ID: WP_279530417.1
• Coordinates: 2387286..2387687 (+)
• Length: 134 a.a.

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
N5O88_RS11460 (N5O88_11465)	2382538..2382852	-	315	WP_279530413.1	transcriptional regulator	-
N5O88_RS11465 (N5O88_11470)	2383007..2383399	+	393	WP_147812150.1	hypothetical protein	-
N5O88_RS11470 (N5O88_11475)	2383592..2384281	-	690	WP_279530414.1	crotonase/enoyl-CoA hydratase family protein	-
N5O88_RS11475 (N5O88_11480)	2384469..2384687	+	219	WP_125879830.1	hypothetical protein	-
N5O88_RS11485 (N5O88_11490)	2385243..2385410	-	168	WP_279530415.1	hypothetical protein	-
N5O88_RS11490 (N5O88_11495)	2385599..2385775	-	177	Protein_2254	IS5/IS1182 family transposase	-
N5O88_RS11495 (N5O88_11500)	2385780..2386340	-	561	Protein_2255	IS66 family transposase zinc-finger binding domain-containing protein	-
N5O88_RS11500 (N5O88_11505)	2386360..2386719	-	360	WP_003460146.1	IS66 family insertion sequence element accessory protein TnpB	-
N5O88_RS11505 (N5O88_11510)	2386987..2387283	+	297	WP_279530416.1	type II toxin-antitoxin system MqsR family toxin	Toxin
N5O88_RS11510 (N5O88_11515)	2387286..2387687	+	402	WP_279530417.1	type II toxin-antitoxin system MqsA family antitoxin	Antitoxin
N5O88_RS11515 (N5O88_11520)	2388080..2388286	+	207	WP_147811840.1	hypothetical protein	-
N5O88_RS11520 (N5O88_11525)	2388394..2389536	+	1143	WP_279530418.1	elongation factor P maturation arginine rhamnosyltransferase EarP	-
N5O88_RS11525 (N5O88_11530)	2389571..2390143	+	573	WP_003240094.1	elongation factor P	-
N5O88_RS11530 (N5O88_11535)	2390217..2391179	-	963	WP_147811837.1	LysR family transcriptional regulator	-
N5O88_RS11535 (N5O88_11540)	2391281..2392048	+	768	WP_279530419.1	sulfite exporter TauE/SafE family protein	-
N5O88_RS11540 (N5O88_11545)	2392043..2392159	-	117	Protein_2264	LysR family transcriptional regulator	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	flank	IS/Tn	-	-	2386360..2386719	359
	-	inside	Genomic island	-	-	2384964..2416916	31952

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• mRNA interferase toxin MqsR (5-97)

Antitoxin

• Antitoxin MqsA/HigA-2 (1-131)

Sequences

Toxin

Protein

• Length: 99 a.a.
• Molecular weight: 11411.18 Da
• Isoelectric Point: 7.2011

>T258481 WP_279530416.1 NZ_CP104583:2386987-2387283 [Pseudomonas sp. GD03721]
MEKRKPHFKLELVKQAITEQRYRFTRVALEGGAELGMEMADMLAVISALSSRDFFKSITTYADHTTWQDVYRPDNEFGQV
YLKFTLVADLLIVSFKEK

Nucleotide

• Length: 297 bp

Antitoxin

Protein

• Length: 134 a.a.
• Molecular weight: 14762.64 Da
• Isoelectric Point: 6.2264

>AT258481 WP_279530417.1 NZ_CP104583:2387286-2387687 [Pseudomonas sp. GD03721]
MKCPVCGGAELVHDTRDMPFTYKGQTTQITAVTADWCDACGESLTGPAESEHVMRAMNEFRQQVNAQDGNQELIRSVRKQ
LRLSQREAAELFGGGPNAFSRYERGSTEAPQPLVQLFKILGRHPELINELRAG

Nucleotide

• Length: 402 bp