Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mqsRA (relBE)/MqsR-MqsA
Location 2386987..2387687 Replicon chromosome
Accession NZ_CP104583
Organism Pseudomonas sp. GD03721

Toxin (Protein)


Gene name mqsR Uniprot ID -
Locus tag N5O88_RS11505 Protein ID WP_279530416.1
Coordinates 2386987..2387283 (+) Length 99 a.a.

Antitoxin (Protein)


Gene name mqsA Uniprot ID -
Locus tag N5O88_RS11510 Protein ID WP_279530417.1
Coordinates 2387286..2387687 (+) Length 134 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N5O88_RS11460 (N5O88_11465) 2382538..2382852 - 315 WP_279530413.1 transcriptional regulator -
N5O88_RS11465 (N5O88_11470) 2383007..2383399 + 393 WP_147812150.1 hypothetical protein -
N5O88_RS11470 (N5O88_11475) 2383592..2384281 - 690 WP_279530414.1 crotonase/enoyl-CoA hydratase family protein -
N5O88_RS11475 (N5O88_11480) 2384469..2384687 + 219 WP_125879830.1 hypothetical protein -
N5O88_RS11485 (N5O88_11490) 2385243..2385410 - 168 WP_279530415.1 hypothetical protein -
N5O88_RS11490 (N5O88_11495) 2385599..2385775 - 177 Protein_2254 IS5/IS1182 family transposase -
N5O88_RS11495 (N5O88_11500) 2385780..2386340 - 561 Protein_2255 IS66 family transposase zinc-finger binding domain-containing protein -
N5O88_RS11500 (N5O88_11505) 2386360..2386719 - 360 WP_003460146.1 IS66 family insertion sequence element accessory protein TnpB -
N5O88_RS11505 (N5O88_11510) 2386987..2387283 + 297 WP_279530416.1 type II toxin-antitoxin system MqsR family toxin Toxin
N5O88_RS11510 (N5O88_11515) 2387286..2387687 + 402 WP_279530417.1 type II toxin-antitoxin system MqsA family antitoxin Antitoxin
N5O88_RS11515 (N5O88_11520) 2388080..2388286 + 207 WP_147811840.1 hypothetical protein -
N5O88_RS11520 (N5O88_11525) 2388394..2389536 + 1143 WP_279530418.1 elongation factor P maturation arginine rhamnosyltransferase EarP -
N5O88_RS11525 (N5O88_11530) 2389571..2390143 + 573 WP_003240094.1 elongation factor P -
N5O88_RS11530 (N5O88_11535) 2390217..2391179 - 963 WP_147811837.1 LysR family transcriptional regulator -
N5O88_RS11535 (N5O88_11540) 2391281..2392048 + 768 WP_279530419.1 sulfite exporter TauE/SafE family protein -
N5O88_RS11540 (N5O88_11545) 2392043..2392159 - 117 Protein_2264 LysR family transcriptional regulator -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- flank IS/Tn - - 2386360..2386719 359
- inside Genomic island - - 2384964..2416916 31952


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase toxin MqsR

(5-97)

Antitoxin

Antitoxin MqsA/HigA-2

(1-131)


Sequences

Toxin        


Download         Length: 99 a.a.        Molecular weight: 11411.18 Da        Isoelectric Point: 7.2011

>T258481 WP_279530416.1 NZ_CP104583:2386987-2387283 [Pseudomonas sp. GD03721]
MEKRKPHFKLELVKQAITEQRYRFTRVALEGGAELGMEMADMLAVISALSSRDFFKSITTYADHTTWQDVYRPDNEFGQV
YLKFTLVADLLIVSFKEK

Download         Length: 297 bp

Antitoxin


Download         Length: 134 a.a.        Molecular weight: 14762.64 Da        Isoelectric Point: 6.2264

>AT258481 WP_279530417.1 NZ_CP104583:2387286-2387687 [Pseudomonas sp. GD03721]
MKCPVCGGAELVHDTRDMPFTYKGQTTQITAVTADWCDACGESLTGPAESEHVMRAMNEFRQQVNAQDGNQELIRSVRKQ
LRLSQREAAELFGGGPNAFSRYERGSTEAPQPLVQLFKILGRHPELINELRAG

Download         Length: 402 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References