Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mqsRA (relBE)/MqsR-MqsA
Location 2388024..2388724 Replicon chromosome
Accession NZ_CP104582
Organism Pseudomonas sp. GD03919

Toxin (Protein)


Gene name mqsR Uniprot ID -
Locus tag N5O87_RS11515 Protein ID WP_279530416.1
Coordinates 2388024..2388320 (+) Length 99 a.a.

Antitoxin (Protein)


Gene name mqsA Uniprot ID -
Locus tag N5O87_RS11520 Protein ID WP_279530417.1
Coordinates 2388323..2388724 (+) Length 134 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N5O87_RS11470 (N5O87_11475) 2383575..2383889 - 315 WP_279530413.1 transcriptional regulator -
N5O87_RS11475 (N5O87_11480) 2384044..2384436 + 393 WP_147812150.1 hypothetical protein -
N5O87_RS11480 (N5O87_11485) 2384629..2385318 - 690 WP_279530414.1 crotonase/enoyl-CoA hydratase family protein -
N5O87_RS11485 (N5O87_11490) 2385506..2385724 + 219 WP_125879830.1 hypothetical protein -
N5O87_RS11495 (N5O87_11500) 2386280..2386447 - 168 WP_279530415.1 hypothetical protein -
N5O87_RS11500 (N5O87_11505) 2386636..2386812 - 177 Protein_2256 IS5/IS1182 family transposase -
N5O87_RS11505 (N5O87_11510) 2386817..2387377 - 561 Protein_2257 IS66 family transposase zinc-finger binding domain-containing protein -
N5O87_RS11510 (N5O87_11515) 2387397..2387756 - 360 WP_003460146.1 IS66 family insertion sequence element accessory protein TnpB -
N5O87_RS11515 (N5O87_11520) 2388024..2388320 + 297 WP_279530416.1 type II toxin-antitoxin system MqsR family toxin Toxin
N5O87_RS11520 (N5O87_11525) 2388323..2388724 + 402 WP_279530417.1 type II toxin-antitoxin system MqsA family antitoxin Antitoxin
N5O87_RS11525 (N5O87_11530) 2389117..2389323 + 207 WP_147811840.1 hypothetical protein -
N5O87_RS11530 (N5O87_11535) 2389431..2390573 + 1143 WP_279530418.1 elongation factor P maturation arginine rhamnosyltransferase EarP -
N5O87_RS11535 (N5O87_11540) 2390608..2391180 + 573 WP_003240094.1 elongation factor P -
N5O87_RS11540 (N5O87_11545) 2391254..2392216 - 963 WP_147811837.1 LysR family transcriptional regulator -
N5O87_RS11545 (N5O87_11550) 2392318..2393085 + 768 WP_279530419.1 sulfite exporter TauE/SafE family protein -
N5O87_RS11550 (N5O87_11555) 2393080..2393196 - 117 Protein_2266 LysR family transcriptional regulator -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 2386001..2417954 31953
- flank IS/Tn - - 2387397..2387756 359


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase toxin MqsR

(5-97)

Antitoxin

Antitoxin MqsA/HigA-2

(1-131)


Sequences

Toxin        


Download         Length: 99 a.a.        Molecular weight: 11411.18 Da        Isoelectric Point: 7.2011

>T258473 WP_279530416.1 NZ_CP104582:2388024-2388320 [Pseudomonas sp. GD03919]
MEKRKPHFKLELVKQAITEQRYRFTRVALEGGAELGMEMADMLAVISALSSRDFFKSITTYADHTTWQDVYRPDNEFGQV
YLKFTLVADLLIVSFKEK

Download         Length: 297 bp

Antitoxin


Download         Length: 134 a.a.        Molecular weight: 14762.64 Da        Isoelectric Point: 6.2264

>AT258473 WP_279530417.1 NZ_CP104582:2388323-2388724 [Pseudomonas sp. GD03919]
MKCPVCGGAELVHDTRDMPFTYKGQTTQITAVTADWCDACGESLTGPAESEHVMRAMNEFRQQVNAQDGNQELIRSVRKQ
LRLSQREAAELFGGGPNAFSRYERGSTEAPQPLVQLFKILGRHPELINELRAG

Download         Length: 402 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References