Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/- |
Location | 639393..640048 | Replicon | chromosome |
Accession | NZ_CP104582 | ||
Organism | Pseudomonas sp. GD03919 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | N5O87_RS03020 | Protein ID | WP_058136484.1 |
Coordinates | 639704..640048 (-) | Length | 115 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | N5O87_RS03015 | Protein ID | WP_027600721.1 |
Coordinates | 639393..639707 (-) | Length | 105 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5O87_RS02980 (N5O87_02980) | 635716..635955 | - | 240 | WP_058136487.1 | entry exclusion lipoprotein TrbK | - |
N5O87_RS02985 (N5O87_02985) | 635966..636745 | - | 780 | WP_279532051.1 | P-type conjugative transfer protein TrbJ | - |
N5O87_RS02990 (N5O87_02990) | 636726..637118 | - | 393 | WP_069734902.1 | hypothetical protein | - |
N5O87_RS02995 (N5O87_02995) | 637115..637387 | - | 273 | WP_279532052.1 | hypothetical protein | - |
N5O87_RS03000 (N5O87_03000) | 637384..637776 | - | 393 | WP_128669104.1 | TraK family protein | - |
N5O87_RS03005 (N5O87_03005) | 637794..638648 | - | 855 | WP_279532053.1 | helix-turn-helix domain-containing protein | - |
N5O87_RS03010 (N5O87_03010) | 638648..638875 | - | 228 | WP_071579492.1 | helix-turn-helix domain-containing protein | - |
N5O87_RS03015 (N5O87_03015) | 639393..639707 | - | 315 | WP_027600721.1 | transcriptional regulator | Antitoxin |
N5O87_RS03020 (N5O87_03020) | 639704..640048 | - | 345 | WP_058136484.1 | hypothetical protein | Toxin |
N5O87_RS03025 (N5O87_03025) | 640096..641169 | - | 1074 | WP_058136483.1 | site-specific integrase | - |
N5O87_RS03035 (N5O87_03035) | 641517..643250 | - | 1734 | WP_279532054.1 | group II intron reverse transcriptase/maturase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 644087..645358 | 1271 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 13407.38 Da Isoelectric Point: 9.9930
>T258471 WP_058136484.1 NZ_CP104582:c640048-639704 [Pseudomonas sp. GD03919]
MKALFVELPPFERHRADYLDDEAFRSFQRLLMKNPEAGDVIQGTGGLRKIRFADERRQKGKRGGIRVIYYWWLGGAQFWL
FTLYGKDVQDDLNEQQKKLLKQLLQAEIDARTTS
MKALFVELPPFERHRADYLDDEAFRSFQRLLMKNPEAGDVIQGTGGLRKIRFADERRQKGKRGGIRVIYYWWLGGAQFWL
FTLYGKDVQDDLNEQQKKLLKQLLQAEIDARTTS
Download Length: 345 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|