Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-VapI |
Location | 289329..289952 | Replicon | chromosome |
Accession | NZ_CP104581 | ||
Organism | Delftia tsuruhatensis strain GD03927 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A1I1B5B2 |
Locus tag | N5O86_RS01275 | Protein ID | WP_016448670.1 |
Coordinates | 289329..289610 (+) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | N5O86_RS01280 | Protein ID | WP_013800141.1 |
Coordinates | 289653..289952 (+) | Length | 100 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5O86_RS01250 (N5O86_01250) | 284685..285548 | + | 864 | WP_279493882.1 | branched-chain amino acid ABC transporter permease | - |
N5O86_RS01255 (N5O86_01255) | 285549..286523 | + | 975 | WP_043792260.1 | branched-chain amino acid ABC transporter permease | - |
N5O86_RS01260 (N5O86_01260) | 286510..287274 | + | 765 | WP_016452146.1 | ABC transporter ATP-binding protein | - |
N5O86_RS01265 (N5O86_01265) | 287261..287968 | + | 708 | WP_016448672.1 | ABC transporter ATP-binding protein | - |
N5O86_RS01270 (N5O86_01270) | 288024..289199 | + | 1176 | WP_016452145.1 | ABC transporter substrate-binding protein | - |
N5O86_RS01275 (N5O86_01275) | 289329..289610 | + | 282 | WP_016448670.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
N5O86_RS01280 (N5O86_01280) | 289653..289952 | + | 300 | WP_013800141.1 | HigA family addiction module antitoxin | Antitoxin |
N5O86_RS01285 (N5O86_01285) | 290045..290818 | - | 774 | WP_279493883.1 | SDR family oxidoreductase | - |
N5O86_RS01290 (N5O86_01290) | 290964..291770 | - | 807 | WP_016448668.1 | IclR family transcriptional regulator | - |
N5O86_RS01295 (N5O86_01295) | 291815..292588 | - | 774 | WP_016448667.1 | ferredoxin--NADP reductase | - |
N5O86_RS01300 (N5O86_01300) | 292850..293785 | - | 936 | WP_279493884.1 | LysR family transcriptional regulator | - |
N5O86_RS01305 (N5O86_01305) | 293878..294669 | + | 792 | WP_279493885.1 | SDR family oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 11057.71 Da Isoelectric Point: 10.1057
>T258462 WP_016448670.1 NZ_CP104581:289329-289610 [Delftia tsuruhatensis]
MTIQSFKCPDTEQLFQQRRVRRWSSIEVVALRKLRMLHAAHVLQDLRVPPGNRLEALQGDRKGQHSIRINDQWRVCFVWT
HEGPSQLEIVDYH
MTIQSFKCPDTEQLFQQRRVRRWSSIEVVALRKLRMLHAAHVLQDLRVPPGNRLEALQGDRKGQHSIRINDQWRVCFVWT
HEGPSQLEIVDYH
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|