258450

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/HigB-HigA
Location 1005366..1005962 Replicon chromosome
Accession NZ_CP104579
Organism Pseudomonas oleovorans strain GD04132

Toxin (Protein)


Gene name higB Uniprot ID A0A379JV42
Locus tag N5O83_RS04785 Protein ID WP_074855597.1
Coordinates 1005684..1005962 (-) Length 93 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID A0A379JW35
Locus tag N5O83_RS04780 Protein ID WP_074855595.1
Coordinates 1005366..1005671 (-) Length 102 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N5O83_RS04750 (N5O83_04755) 1000496..1000969 + 474 WP_279534489.1 hypothetical protein -
N5O83_RS04755 (N5O83_04760) 1001704..1003029 + 1326 WP_170961187.1 group II intron reverse transcriptase/maturase -
N5O83_RS04760 (N5O83_04765) 1003101..1004054 - 954 WP_004424207.1 IS1595-like element ISAchd1 family transposase -
N5O83_RS04765 (N5O83_04770) 1004172..1004768 - 597 WP_279534490.1 putative adenosine monophosphate-protein transferase Fic -
N5O83_RS04770 (N5O83_04775) 1004833..1004928 - 96 Protein_944 YhfG family protein -
N5O83_RS04775 (N5O83_04780) 1005051..1005286 - 236 Protein_945 transcriptional regulator -
N5O83_RS04780 (N5O83_04785) 1005366..1005671 - 306 WP_074855595.1 HigA family addiction module antitoxin Antitoxin
N5O83_RS04785 (N5O83_04790) 1005684..1005962 - 279 WP_074855597.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
N5O83_RS04790 (N5O83_04795) 1006152..1006463 - 312 WP_083393707.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
N5O83_RS04795 (N5O83_04800) 1006551..1006754 + 204 WP_279534491.1 IS66 family insertion sequence element accessory protein TnpB -
N5O83_RS04800 (N5O83_04805) 1007266..1008534 + 1269 WP_003459714.1 group II intron reverse transcriptase/maturase -
N5O83_RS04805 (N5O83_04810) 1008568..1008771 + 204 WP_003462030.1 IS66 family insertion sequence element accessory protein TnpB -
N5O83_RS04810 (N5O83_04815) 1008791..1010350 + 1560 WP_279534492.1 IS66 family transposase -
N5O83_RS04815 (N5O83_04820) 1010402..1010575 - 174 WP_279534493.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 986671..1022067 35396
- inside IScluster/Tn - - 1003101..1010350 7249


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-1

(4-92)

Antitoxin

Cro/C1-type helix-turn-helix domain

(18-69)


Sequences

Toxin        


Download         Length: 93 a.a.        Molecular weight: 10526.98 Da        Isoelectric Point: 8.5556

>T258450 WP_074855597.1 NZ_CP104579:c1005962-1005684 [Pseudomonas oleovorans]
MILSFRCAETQALFESGSSRRWASILNVATRKLTMLNAAVELRDLRSPPGNRLEQLQGNRADQHSIRINDQWRICFVWTA
AGPTQVEIVDYH

Download         Length: 279 bp

Antitoxin


Download         Length: 102 a.a.        Molecular weight: 11115.67 Da        Isoelectric Point: 4.7616

>AT258450 WP_074855595.1 NZ_CP104579:c1005671-1005366 [Pseudomonas oleovorans]
MTINGMRPVHPGEVLREEFLEPLGMTPAALARALHVSAPTINDIVRERRGITADTAIRLGRYFDTSAQFWMNLQTEYALA
TTYAESGAAIEQAIEPLQIAS

Download         Length: 306 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A379JV42

Antitoxin

Source ID Structure
AlphaFold DB A0A379JW35

References