Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
| Location | 2518907..2519091 | Replicon | chromosome |
| Accession | NZ_CP104559 | ||
| Organism | Staphylococcus aureus strain SA2107 | ||
Toxin (Protein)
| Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
| Locus tag | N4T05_RS12695 | Protein ID | WP_000482647.1 |
| Coordinates | 2518984..2519091 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | SprA2AS | ||
| Locus tag | - | ||
| Coordinates | 2518907..2518967 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N4T05_RS12675 | 2514493..2514660 | - | 168 | WP_031785511.1 | hypothetical protein | - |
| N4T05_RS12680 | 2514891..2516624 | - | 1734 | WP_000488492.1 | ABC transporter ATP-binding protein | - |
| N4T05_RS12685 | 2516673..2518412 | - | 1740 | WP_234739903.1 | ABC transporter ATP-binding protein | - |
| N4T05_RS12690 | 2518790..2518957 | - | 168 | WP_000301894.1 | hypothetical protein | - |
| - | 2518907..2518967 | + | 61 | - | - | Antitoxin |
| N4T05_RS12695 | 2518984..2519091 | - | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
| N4T05_RS12700 | 2519225..2519611 | - | 387 | WP_000779354.1 | flippase GtxA | - |
| N4T05_RS12705 | 2519879..2521021 | + | 1143 | WP_103215193.1 | glycerate kinase | - |
| N4T05_RS12710 | 2521081..2521740 | + | 660 | WP_000831298.1 | membrane protein | - |
| N4T05_RS12715 | 2521920..2523131 | + | 1212 | WP_001191975.1 | multidrug effflux MFS transporter | - |
| N4T05_RS12720 | 2523254..2523727 | - | 474 | WP_000456491.1 | GyrI-like domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T258444 WP_000482647.1 NZ_CP104559:c2519091-2518984 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
Antitoxin
Download Length: 61 bp
>AT258444 NZ_CP104559:2518907-2518967 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|