Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-SprF1/- |
| Location | 2063035..2063342 | Replicon | chromosome |
| Accession | NZ_CP104559 | ||
| Organism | Staphylococcus aureus strain SA2107 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | Q2FWU9 |
| Locus tag | N4T05_RS10280 | Protein ID | WP_011447039.1 |
| Coordinates | 2063166..2063342 (-) | Length | 59 a.a. |
Antitoxin (RNA)
| Gene name | SprF1 | ||
| Locus tag | - | ||
| Coordinates | 2063035..2063174 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N4T05_RS10240 (2058374) | 2058374..2058634 | + | 261 | WP_001791826.1 | hypothetical protein | - |
| N4T05_RS10245 (2058687) | 2058687..2059037 | - | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
| N4T05_RS10250 (2059722) | 2059722..2060171 | + | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
| N4T05_RS10255 (2060266) | 2060266..2060601 | - | 336 | Protein_1981 | SH3 domain-containing protein | - |
| N4T05_RS10260 (2061251) | 2061251..2061742 | - | 492 | WP_000919350.1 | staphylokinase | - |
| N4T05_RS10265 (2061933) | 2061933..2062688 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| N4T05_RS10270 (2062700) | 2062700..2062954 | - | 255 | WP_000611512.1 | phage holin | - |
| N4T05_RS10275 (2063006) | 2063006..2063113 | + | 108 | WP_001791821.1 | hypothetical protein | - |
| - (2063035) | 2063035..2063174 | + | 140 | NuclAT_0 | - | Antitoxin |
| - (2063035) | 2063035..2063174 | + | 140 | NuclAT_0 | - | Antitoxin |
| - (2063035) | 2063035..2063174 | + | 140 | NuclAT_0 | - | Antitoxin |
| - (2063035) | 2063035..2063174 | + | 140 | NuclAT_0 | - | Antitoxin |
| N4T05_RS10280 (2063166) | 2063166..2063342 | - | 177 | WP_011447039.1 | type I toxin-antitoxin system toxin PepG1 | Toxin |
| N4T05_RS10285 (2063492) | 2063492..2063788 | - | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
| N4T05_RS10290 (2063846) | 2063846..2064133 | - | 288 | WP_001040261.1 | hypothetical protein | - |
| N4T05_RS10295 (2064180) | 2064180..2064332 | - | 153 | WP_001153681.1 | hypothetical protein | - |
| N4T05_RS10300 (2064322) | 2064322..2068107 | - | 3786 | WP_000582165.1 | phage tail spike protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | scn / chp / sak / hlb / groEL | 2058687..2109024 | 50337 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T258440 WP_011447039.1 NZ_CP104559:c2063342-2063166 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
Antitoxin
Download Length: 140 bp
>AT258440 NZ_CP104559:2063035-2063174 [Staphylococcus aureus]
ATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGGCTATTTTAGATTAAA
GATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGATGGTTATTTTTT
ATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGGCTATTTTAGATTAAA
GATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGATGGTTATTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|