Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/HigB-HigA
Location 849806..850421 Replicon chromosome
Accession NZ_CP104555
Organism Vibrio sp. J502

Toxin (Protein)


Gene name higB Uniprot ID -
Locus tag N5E84_RS19675 Protein ID WP_029388214.1
Coordinates 850134..850421 (-) Length 96 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag N5E84_RS19670 Protein ID WP_001232701.1
Coordinates 849806..850123 (-) Length 106 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N5E84_RS19625 (N5E84_19625) 844985..846517 - 1533 WP_069212063.1 IS66-like element ISVa9 family transposase -
N5E84_RS19630 (N5E84_19630) 846577..846930 - 354 WP_069212062.1 IS66 family insertion sequence element accessory protein TnpB -
N5E84_RS19635 (N5E84_19635) 846927..847247 - 321 WP_081245520.1 hypothetical protein -
N5E84_RS19640 (N5E84_19640) 847331..847684 + 354 Protein_756 transposase -
N5E84_RS19645 (N5E84_19645) 847691..847924 - 234 WP_116285044.1 hypothetical protein -
N5E84_RS19650 (N5E84_19650) 847944..848066 - 123 WP_199731798.1 DUF3265 domain-containing protein -
N5E84_RS19655 (N5E84_19655) 848257..849228 + 972 WP_019282910.1 IS110 family transposase -
N5E84_RS19660 (N5E84_19660) 849241..849657 - 417 WP_017045395.1 VOC family protein -
N5E84_RS19665 (N5E84_19665) 849699..849809 - 111 WP_232513712.1 DUF3265 domain-containing protein -
N5E84_RS19670 (N5E84_19670) 849806..850123 - 318 WP_001232701.1 HigA family addiction module antitoxin Antitoxin
N5E84_RS19675 (N5E84_19675) 850134..850421 - 288 WP_029388214.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
N5E84_RS19680 (N5E84_19680) 850725..850955 + 231 WP_013868597.1 PAS factor family protein -
N5E84_RS19685 (N5E84_19685) 851075..851269 - 195 WP_081317735.1 DUF1289 domain-containing protein -
N5E84_RS19690 (N5E84_19690) 851316..852466 + 1151 WP_095661212.1 IS3 family transposase -
N5E84_RS19695 (N5E84_19695) 852773..853224 - 452 Protein_767 lipocalin family protein -
N5E84_RS19700 (N5E84_19700) 853476..853760 + 285 WP_017040620.1 type II toxin-antitoxin system RelB/DinJ family antitoxin -
N5E84_RS19705 (N5E84_19705) 853757..854035 + 279 WP_010320663.1 type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family -
N5E84_RS19710 (N5E84_19710) 854064..854180 - 117 WP_094145943.1 DUF3265 domain-containing protein -
N5E84_RS19715 (N5E84_19715) 854177..854656 - 480 WP_017045717.1 lecithin retinol acyltransferase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 850134..914576 64442
- inside IScluster/Tn - - 830576..852466 21890
- inside Integron - - 837523..869844 32321


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-1

(4-93)

Antitoxin

Cro/C1-type helix-turn-helix domain

(12-69)


Sequences

Toxin        


Download         Length: 96 a.a.        Molecular weight: 11350.93 Da        Isoelectric Point: 6.7187

>T258429 WP_029388214.1 NZ_CP104555:c850421-850134 [Vibrio sp. J502]
MALEFKDKWLEQFYEDDKRHRLIPSSIESALFRKLEILDAAQAESDLRIPPGNRFEHLEGNLKGWCSIRVNKQYRLIFQW
VDGVALNTYLDPHRY

Download         Length: 288 bp

Antitoxin


Download         Length: 106 a.a.        Molecular weight: 11705.63 Da        Isoelectric Point: 10.4711

>AT258429 WP_001232701.1 NZ_CP104555:c850123-849806 [Vibrio sp. J502]
MRKTKRRPVSVGEMLKVEFLEPMGITSKALAEAMGVHRNTVSNLINGGVLTAPVAIKLAAALGNTPEFWLNIQHAVDLWD
TRNRYQEEAKFVKPLFVSLEQSART

Download         Length: 318 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References