Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 69237..69501 | Replicon | plasmid p2 |
| Accession | NZ_CP104541 | ||
| Organism | Escherichia coli strain E6 | ||
Toxin (Protein)
| Gene name | pndA | Uniprot ID | U9Y6M3 |
| Locus tag | N5O76_RS25040 | Protein ID | WP_001331364.1 |
| Coordinates | 69349..69501 (+) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | pndB | ||
| Locus tag | - | ||
| Coordinates | 69237..69294 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5O76_RS25025 (64476) | 64476..66767 | - | 2292 | WP_001289276.1 | F-type conjugative transfer protein TrbC | - |
| N5O76_RS25030 (66760) | 66760..67830 | - | 1071 | WP_000151583.1 | IncI1-type conjugal transfer protein TrbB | - |
| N5O76_RS25035 (67849) | 67849..69057 | - | 1209 | WP_000121274.1 | IncI1-type conjugal transfer protein TrbA | - |
| - (69237) | 69237..69294 | - | 58 | NuclAT_0 | - | Antitoxin |
| - (69237) | 69237..69294 | - | 58 | NuclAT_0 | - | Antitoxin |
| - (69237) | 69237..69294 | - | 58 | NuclAT_0 | - | Antitoxin |
| - (69237) | 69237..69294 | - | 58 | NuclAT_0 | - | Antitoxin |
| N5O76_RS25040 (69349) | 69349..69501 | + | 153 | WP_001331364.1 | Hok/Gef family protein | Toxin |
| N5O76_RS25045 (70124) | 70124..70420 | + | 297 | WP_001275298.1 | DinQ-like type I toxin DqlB | - |
| N5O76_RS25050 (70485) | 70485..70661 | - | 177 | WP_001054904.1 | hypothetical protein | - |
| N5O76_RS25055 (71053) | 71053..71262 | + | 210 | WP_000062603.1 | HEAT repeat domain-containing protein | - |
| N5O76_RS25060 (71334) | 71334..71996 | - | 663 | WP_000653334.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
| N5O76_RS25065 (72061) | 72061..74223 | - | 2163 | WP_000698351.1 | DotA/TraY family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | sul1 / qacE / aac(3)-VIa / ant(3'')-Ia | - | 1..114993 | 114993 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5775.13 Da Isoelectric Point: 8.7948
>T258401 WP_001331364.1 NZ_CP104541:69349-69501 [Escherichia coli]
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
Antitoxin
Download Length: 58 bp
>AT258401 NZ_CP104541:c69294-69237 [Escherichia coli]
GCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
GCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|