Detailed information of TA system TA258396

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 138255..138681
• Replicon: plasmid p1
• Accession: NZ_CP104540
• Organism: Escherichia coli strain E6

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: N5O76_RS24375
• Protein ID: WP_001372321.1
• Coordinates: 138255..138380 (-)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	138457..138681 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
N5O76_RS24335 (133625)	133625..134314	-	690	WP_000283385.1	conjugal transfer transcriptional regulator TraJ	-
N5O76_RS24340 (134501)	134501..134884	-	384	WP_001151524.1	conjugal transfer relaxosome DNA-binding protein TraM	-
N5O76_RS24345 (135205)	135205..135807	+	603	WP_000243709.1	transglycosylase SLT domain-containing protein	-
N5O76_RS24350 (136104)	136104..136925	-	822	WP_001234469.1	DUF932 domain-containing protein	-
N5O76_RS24355 (137046)	137046..137333	-	288	WP_000107535.1	hypothetical protein	-
N5O76_RS24360 (137358)	137358..137564	-	207	WP_000547939.1	hypothetical protein	-
N5O76_RS24365 (137634)	137634..137807	+	174	Protein_141	hypothetical protein	-
N5O76_RS24370 (137805)	137805..138035	-	231	WP_001426396.1	hypothetical protein	-
N5O76_RS24375 (138255)	138255..138380	-	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
N5O76_RS24380 (138322)	138322..138471	-	150	Protein_144	plasmid maintenance protein Mok	-
- (138457)	138457..138681	-	225	NuclAT_0	-	Antitoxin
- (138457)	138457..138681	-	225	NuclAT_0	-	Antitoxin
- (138457)	138457..138681	-	225	NuclAT_0	-	Antitoxin
- (138457)	138457..138681	-	225	NuclAT_0	-	Antitoxin
N5O76_RS24385 (138493)	138493..138681	+	189	WP_001299721.1	hypothetical protein	-
N5O76_RS24390 (138650)	138650..139412	-	763	Protein_146	plasmid SOS inhibition protein A	-
N5O76_RS24395 (139409)	139409..139843	-	435	WP_000845949.1	conjugation system SOS inhibitor PsiB	-
N5O76_RS24400 (139898)	139898..141856	-	1959	WP_160348044.1	ParB/RepB/Spo0J family partition protein	-
N5O76_RS24405 (141915)	141915..142148	-	234	WP_000006004.1	DUF905 domain-containing protein	-
N5O76_RS24410 (142204)	142204..142689	-	486	WP_042029316.1	single-stranded DNA-binding protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	sitABCD	iroB / iroC / iroD / iroE / iroN / vat / iutA / iucD / iucC / iucB / iucA	1..182456	182456

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T258396 WP_001372321.1 NZ_CP104540:c138380-138255 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 225 bp

>AT258396 NZ_CP104540:c138681-138457 [Escherichia coli]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Antitoxin