Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 138255..138681 | Replicon | plasmid p1 |
| Accession | NZ_CP104540 | ||
| Organism | Escherichia coli strain E6 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | N5O76_RS24375 | Protein ID | WP_001372321.1 |
| Coordinates | 138255..138380 (-) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 138457..138681 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5O76_RS24335 (133625) | 133625..134314 | - | 690 | WP_000283385.1 | conjugal transfer transcriptional regulator TraJ | - |
| N5O76_RS24340 (134501) | 134501..134884 | - | 384 | WP_001151524.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| N5O76_RS24345 (135205) | 135205..135807 | + | 603 | WP_000243709.1 | transglycosylase SLT domain-containing protein | - |
| N5O76_RS24350 (136104) | 136104..136925 | - | 822 | WP_001234469.1 | DUF932 domain-containing protein | - |
| N5O76_RS24355 (137046) | 137046..137333 | - | 288 | WP_000107535.1 | hypothetical protein | - |
| N5O76_RS24360 (137358) | 137358..137564 | - | 207 | WP_000547939.1 | hypothetical protein | - |
| N5O76_RS24365 (137634) | 137634..137807 | + | 174 | Protein_141 | hypothetical protein | - |
| N5O76_RS24370 (137805) | 137805..138035 | - | 231 | WP_001426396.1 | hypothetical protein | - |
| N5O76_RS24375 (138255) | 138255..138380 | - | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| N5O76_RS24380 (138322) | 138322..138471 | - | 150 | Protein_144 | plasmid maintenance protein Mok | - |
| - (138457) | 138457..138681 | - | 225 | NuclAT_0 | - | Antitoxin |
| - (138457) | 138457..138681 | - | 225 | NuclAT_0 | - | Antitoxin |
| - (138457) | 138457..138681 | - | 225 | NuclAT_0 | - | Antitoxin |
| - (138457) | 138457..138681 | - | 225 | NuclAT_0 | - | Antitoxin |
| N5O76_RS24385 (138493) | 138493..138681 | + | 189 | WP_001299721.1 | hypothetical protein | - |
| N5O76_RS24390 (138650) | 138650..139412 | - | 763 | Protein_146 | plasmid SOS inhibition protein A | - |
| N5O76_RS24395 (139409) | 139409..139843 | - | 435 | WP_000845949.1 | conjugation system SOS inhibitor PsiB | - |
| N5O76_RS24400 (139898) | 139898..141856 | - | 1959 | WP_160348044.1 | ParB/RepB/Spo0J family partition protein | - |
| N5O76_RS24405 (141915) | 141915..142148 | - | 234 | WP_000006004.1 | DUF905 domain-containing protein | - |
| N5O76_RS24410 (142204) | 142204..142689 | - | 486 | WP_042029316.1 | single-stranded DNA-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | sitABCD | iroB / iroC / iroD / iroE / iroN / vat / iutA / iucD / iucC / iucB / iucA | 1..182456 | 182456 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T258396 WP_001372321.1 NZ_CP104540:c138380-138255 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 225 bp
>AT258396 NZ_CP104540:c138681-138457 [Escherichia coli]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|