Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 97314..97568 | Replicon | plasmid p1 |
| Accession | NZ_CP104540 | ||
| Organism | Escherichia coli strain E6 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | N5O76_RS24130 | Protein ID | WP_001312851.1 |
| Coordinates | 97314..97463 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 97507..97568 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5O76_RS24095 (93644) | 93644..93931 | - | 288 | WP_000222766.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| N5O76_RS24100 (93928) | 93928..94179 | - | 252 | WP_001132900.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
| N5O76_RS24105 (95142) | 95142..95999 | - | 858 | WP_000774297.1 | incFII family plasmid replication initiator RepA | - |
| N5O76_RS24110 (95992) | 95992..96474 | - | 483 | WP_001273588.1 | hypothetical protein | - |
| N5O76_RS24115 (96467) | 96467..96514 | - | 48 | WP_229471593.1 | hypothetical protein | - |
| N5O76_RS24120 (96505) | 96505..96756 | + | 252 | WP_223195197.1 | replication protein RepA | - |
| N5O76_RS24125 (96773) | 96773..97030 | - | 258 | WP_000083845.1 | replication regulatory protein RepA | - |
| N5O76_RS24130 (97314) | 97314..97463 | - | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| - (97507) | 97507..97568 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (97507) | 97507..97568 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (97507) | 97507..97568 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (97507) | 97507..97568 | + | 62 | NuclAT_1 | - | Antitoxin |
| N5O76_RS24135 (97824) | 97824..97898 | - | 75 | Protein_95 | endonuclease | - |
| N5O76_RS24140 (98144) | 98144..98356 | - | 213 | WP_001299730.1 | ANR family transcriptional regulator | - |
| N5O76_RS24145 (98492) | 98492..99052 | - | 561 | WP_000139315.1 | fertility inhibition protein FinO | - |
| N5O76_RS24150 (99155) | 99155..100015 | - | 861 | WP_000704513.1 | alpha/beta hydrolase | - |
| N5O76_RS24155 (100074) | 100074..100820 | - | 747 | WP_000205749.1 | conjugal transfer pilus acetylase TraX | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | sitABCD | iroB / iroC / iroD / iroE / iroN / vat / iutA / iucD / iucC / iucB / iucA | 1..182456 | 182456 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T258391 WP_001312851.1 NZ_CP104540:c97463-97314 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 62 bp
>AT258391 NZ_CP104540:97507-97568 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
