Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
| Location | 604995..605794 | Replicon | chromosome |
| Accession | NZ_CP104539 | ||
| Organism | Escherichia coli strain E6 | ||
Toxin (Protein)
| Gene name | yhaV | Uniprot ID | U9XVR9 |
| Locus tag | N5O76_RS02985 | Protein ID | WP_000347267.1 |
| Coordinates | 604995..605459 (-) | Length | 155 a.a. |
Antitoxin (Protein)
| Gene name | prlF | Uniprot ID | S1EB98 |
| Locus tag | N5O76_RS02990 | Protein ID | WP_001307405.1 |
| Coordinates | 605459..605794 (-) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5O76_RS02955 (599996) | 599996..600430 | - | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
| N5O76_RS02960 (600448) | 600448..601326 | - | 879 | WP_001295548.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
| N5O76_RS02965 (601316) | 601316..602095 | - | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
| N5O76_RS02970 (602106) | 602106..602579 | - | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
| N5O76_RS02975 (602602) | 602602..603882 | - | 1281 | WP_000681933.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
| N5O76_RS02980 (604131) | 604131..604940 | + | 810 | WP_000072193.1 | aga operon transcriptional regulator AgaR | - |
| N5O76_RS02985 (604995) | 604995..605459 | - | 465 | WP_000347267.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
| N5O76_RS02990 (605459) | 605459..605794 | - | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
| N5O76_RS02995 (605943) | 605943..607514 | - | 1572 | WP_001273741.1 | galactarate dehydratase | - |
| N5O76_RS03000 (607889) | 607889..609223 | + | 1335 | WP_160348001.1 | galactarate/glucarate/glycerate transporter GarP | - |
| N5O76_RS03005 (609239) | 609239..610009 | + | 771 | WP_261306653.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 604995..617729 | 12734 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17807.17 Da Isoelectric Point: 9.4947
>T258368 WP_000347267.1 NZ_CP104539:c605459-604995 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E0XTR4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E0XVC7 |