Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 79604..80030 | Replicon | plasmid p1 |
Accession | NZ_CP104537 | ||
Organism | Escherichia coli strain E3 |
Toxin (Protein)
Gene name | hok | Uniprot ID | - |
Locus tag | N5O72_RS23135 | Protein ID | WP_001372321.1 |
Coordinates | 79604..79729 (-) | Length | 42 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 79806..80030 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5O72_RS23095 (74973) | 74973..75662 | - | 690 | WP_000283380.1 | conjugal transfer transcriptional regulator TraJ | - |
N5O72_RS23100 (75849) | 75849..76232 | - | 384 | WP_053320747.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
N5O72_RS23105 (76553) | 76553..77155 | + | 603 | WP_224476533.1 | transglycosylase SLT domain-containing protein | - |
N5O72_RS23110 (77452) | 77452..78273 | - | 822 | WP_001234469.1 | DUF932 domain-containing protein | - |
N5O72_RS23115 (78395) | 78395..78682 | - | 288 | WP_000107535.1 | hypothetical protein | - |
N5O72_RS23120 (78707) | 78707..78913 | - | 207 | WP_000547939.1 | hypothetical protein | - |
N5O72_RS23125 (78983) | 78983..79156 | + | 174 | Protein_83 | hypothetical protein | - |
N5O72_RS23130 (79154) | 79154..79384 | - | 231 | WP_071587244.1 | hypothetical protein | - |
N5O72_RS23135 (79604) | 79604..79729 | - | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
N5O72_RS23140 (79671) | 79671..79820 | - | 150 | Protein_86 | plasmid maintenance protein Mok | - |
- (79806) | 79806..80030 | - | 225 | NuclAT_0 | - | Antitoxin |
- (79806) | 79806..80030 | - | 225 | NuclAT_0 | - | Antitoxin |
- (79806) | 79806..80030 | - | 225 | NuclAT_0 | - | Antitoxin |
- (79806) | 79806..80030 | - | 225 | NuclAT_0 | - | Antitoxin |
N5O72_RS23145 (79842) | 79842..80030 | + | 189 | WP_001299721.1 | hypothetical protein | - |
N5O72_RS23150 (79999) | 79999..80761 | - | 763 | Protein_88 | plasmid SOS inhibition protein A | - |
N5O72_RS23155 (80758) | 80758..81192 | - | 435 | WP_000845934.1 | conjugation system SOS inhibitor PsiB | - |
N5O72_RS23160 (81247) | 81247..83205 | - | 1959 | WP_023148339.1 | ParB/RepB/Spo0J family partition protein | - |
N5O72_RS23165 (83271) | 83271..83504 | - | 234 | WP_000005990.1 | DUF905 family protein | - |
N5O72_RS23170 (83567) | 83567..84064 | - | 498 | WP_089552049.1 | single-stranded DNA-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T258364 WP_001372321.1 NZ_CP104537:c79729-79604 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 225 bp
>AT258364 NZ_CP104537:c80030-79806 [Escherichia coli]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|